KEGG   Pongo abelii (Sumatran orangutan): 100449142Help
Entry
100449142         CDS       T01416                                 

Definition
glutathione S-transferase-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100449142
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100449142
   00982 Drug metabolism - cytochrome P450
    100449142
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100449142
Enzymes [BR:pon01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100449142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 283 aa AA seqDB search
MEGKSKLYYFNGRGRMESIRWLLAAARVEIYNFAEMAVLCLSLEPLLYLTQLLTQSAFKQ
KIKLKIFKSSGAKPLWCDLAKLNQNVAENSSGGTLMYGQVPMVETHGMNXVETRAILRYI
AAKYDLYGRNMKEQTWIHMYVEGLKDLSDMIMFWPLSLPEEKEMNLAYILERATTRLFPV
CEKALRDHRQDFLVGNRLSWADTQQSEVILMTEECKPSVLLGFPLLQKFKARISHILTIN
KFLQPGSQRKPPLDEESIKTVKNIFKLERGMFLKNMSTAVAKY
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaagtccaagctttactacttcaatggaagaggcaggatggaatccatccga
tggctcttggctgcagctagagtagagatatacaattttgctgaaatggctgtgctttgc
ttgtctttggagcccctgctgtacctcacacagctcctcacacaatcagcctttaagcaa
aagataaaattgaagatttttaaaagttcaggagcgaaacctctttggtgtgatctggcg
aaactcaatcaaaatgtagcagaaaattcttcaggtggaaccctgatgtatggacaagtg
cccatggttgaaactcatggaatgaattaggtagaaaccagagccatcctaagatacata
gctgcaaaatatgacttgtatggaaggaatatgaaggaacaaacctggattcacatgtat
gtagaaggcttaaaggacctgagtgacatgattatgttctggccactctctctgcctgaa
gagaaggagatgaatcttgcatacatccttgaaagagccactacaagattattccccgtc
tgtgagaaggcactgagagaccatagacaagattttctcgtgggcaatcggctgagttgg
gctgatacacagcaatctgaagtcatcttaatgactgaagagtgcaaacccagtgtcctc
ttgggctttcctctgctacagaaattcaaggccagaatcagccacatcctcacaattaat
aaatttctccaacctggaagccaaaggaagcctccactggatgaagaatccattaagact
gtgaagaacatatttaaacttgaacgtggcatgtttcttaaaaacatgagcactgcagta
gctaagtattaa

DBGET integrated database retrieval system