KEGG   Pongo abelii (Sumatran orangutan): 100449142Help
Entry
100449142         CDS       T01416                                 

Definition
(RefSeq) glutathione S-transferase-like
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100449142
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100449142
   00982 Drug metabolism - cytochrome P450
    100449142
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100449142
   05225 Hepatocellular carcinoma
    100449142
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100449142
  Drug resistance
   01524 Platinum drug resistance
    100449142
Enzymes [BR:pon01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100449142
Transporters [BR:pon02000]
 Other Transporters
  Pores ion channels [TC:1]
   100449142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
6
AA seq 201 aa AA seqDB search
MEGKSKLYYFNGRGRMESIRWLLAAARVELQLVGWLVDWLVGFNAKDSLGRLKKIHMYVE
GLKDLSDMIMFWPLSLPEEKEMNLAYILERATTRLFPVCEKALRDHRQDFLVGNRLSWAD
TQQSEVILMTEECKPSVLLGFPLLQKFKARISHILTINKFLQPGSQRKPPLDEESIKTVK
NIFKLERGMFLKNMSTAVAKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaagtccaagctttactacttcaatggaagaggcaggatggaatccatccga
tggctcttggctgcagctagagtagagttacagttggttggctggttggttgattggttg
gttggttttaatgcaaaagattccttgggaagattgaaaaagattcacatgtatgtagaa
ggcttaaaggacctgagtgacatgattatgttctggccactctctctgcctgaagagaag
gagatgaatcttgcatacatccttgaaagagccactacaagattattccccgtctgtgag
aaggcactgagagaccatagacaagattttctcgtgggcaatcggctgagttgggctgat
acacagcaatctgaagtcatcttaatgactgaagagtgcaaacccagtgtcctcttgggc
tttcctctgctacagaaattcaaggccagaatcagccacatcctcacaattaataaattt
ctccaacctggaagccaaaggaagcctccactggatgaagaatccattaagactgtgaag
aacatatttaaacttgaacgtggcatgtttcttaaaaacatgagcactgcagtagctaag
tattaa

DBGET integrated database retrieval system