KEGG   Pongo abelii (Sumatran orangutan): 100449213Help
Entry
100449213         CDS       T01416                                 

Gene name
MAP2K5
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 5 isoform X1
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04540  Gap junction
pon04722  Neurotrophin signaling pathway
pon04921  Oxytocin signaling pathway
pon05418  Fluid shear stress and atherosclerosis
Module
pon_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100449213 (MAP2K5)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100449213 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100449213 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    100449213 (MAP2K5)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100449213 (MAP2K5)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100449213 (MAP2K5)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE7 family
   100449213 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 100449213
NCBI-ProteinID: XP_002825634
Ensembl: ENSPPYG00000006587
UniProt: H2NNK7
Position
15
AA seq 448 aa AA seqDB search
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNATVVSMWVCRALEERRSQQGPP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctagcccttggcccctttcctgccatggagaaccaggtgctggtaattcgc
atcaagatcccaaatagtggcgcggtggactggacagtgcactccgggccgcagttactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaactacagcattt
gaatatgaagatgaagatggtgatcgaattacagtgagaagtgatgaggaaatgaaggca
atgctgtcatattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatactcgggccggaccctctcaacacagcagcccagcagtctcagattcactt
ccaagcaatagcttaaagaagtcttctgctgaactgaaaaaaatattagccaatggccag
atgaatgaacaagacatacgatatcgggacactcttggtcatggcaacggaggcacagtc
tacaaagcatatcatgtcccgagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcattggattttatggagcattttttgtagaaaacaggatttcaatatgt
acagaattcatggatgggggatctttggatgtatataggaaaatgccagaacatgtcctt
ggaagaattgcagtagcagttgttaaaggccttacttatttgtggagtttaaagatttta
catagagacgtgaagccctccaatatgctagtaaacacaagaggacaggttaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaaggatttcaggggagcagtatggaattcattctgatgtctgg
agcttaggaatctcttttatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccagttggagagttctcggagccatttgtacatttcatcactcagtgtatg
cgaaaacagccaaaagaaaggccagcacctgaagaattgatgggccacccgttcatcgtg
cagttcaatgatggaaacgccaccgtggtgtccatgtgggtgtgccgggcgctggaggag
aggcggagccagcaggggcccccgtga

DBGET integrated database retrieval system