KEGG   Pongo abelii (Sumatran orangutan): 100449391Help
Entry
100449391         CDS       T01416                                 

Gene name
MRPS18B
Definition
(RefSeq) 28S ribosomal protein S18b, mitochondrial
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100449391 (MRPS18B)
Ribosome [BR:pon03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    100449391 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 zf-RING_10 HTH_21
Motif
Other DBs
NCBI-GeneID: 100449391
NCBI-ProteinID: XP_024103907
Ensembl: ENSPPYG00000016412
Position
6
AA seq 258 aa AA seqDB search
MAASVLNILLRRLPMLSLLRGSHRVQVPLQTLCTKALSEEDSLSPVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRGNKVVGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTS
HGAVSATPPAPTLISGDPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKMPP
TTPAEASSTGQTGPQSAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgtattaaacatcctgctgaggcggcttcctatgctttctctcctccga
ggttctcacagagttcaggttcccctgcaaactctttgcaccaaagctctctctgaggaa
gattctttgtccccagttcccatttctccttataaggatgagccctggaaatatctggaa
tcagaagaataccaggagcgatatggttctcgccccgtctgggctgactaccgccgcaac
cacaagggtggtgtacccccacagcggactcggaagacatgtattcgtgggaataaagtt
gttgggaatccctgccccatctgccgagatcacaagttgcatgttgactttaggaacgtg
aagctcttggaacaatttgtctgcgcccacacgggtatcatcttccatgctccatacaca
ggagtctgtgtgaagcagcacaagaggttgacccaggccatccagaaagccagggatcat
ggtctcctcatttaccacatcccccaggttgaaccacgggaccttgacttcagtacctct
catggggctgtgagtgctactccgccagcccccaccctgatctcaggtgacccttggtac
ccatggtacaactggaaacagccaccggagagagaactgtctcgccttcgccggctttac
cagggtcatctccgagaagagagtggccccccacctgagtcaatgcccaagatgccccct
acaacaccagcggaagcctcctccactgggcagacaggcccccagagtgctctgtag

DBGET integrated database retrieval system