KEGG   Pongo abelii (Sumatran orangutan): 100449391Help
Entry
100449391         CDS       T01416                                 

Gene name
MRPS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100449391 (MRPS18B)
Ribosome [BR:pon03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100449391 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 257 aa AA seqDB search
MAASVLNILLRRLPMLSLLRGSHRVQVPLQTLCTKALSEEDSLSPVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRGEDLAALPASFLTFLYHSPPQNVK
LLEQFVCAHTGIIFHAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSH
GAVSATPPAPTLISGDPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKMPPT
TPAEASSTGQTGPQSAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgtattaaacatcctgctgaggcggcttcctatgctttctctcctccga
ggttctcacagagttcaggttcccctgcagactctttgcaccaaagctctctctgaggaa
gattctttgtccccagttcccatttctccttataaggatgagccctggaaatatctggaa
tcagaagaataccaggagcgatatggttctcgccccgtctgggctgactaccgccgcaac
cacaagggtggtgtacccccacagcggactcggaagacatgtattaggggtgaagatctt
gctgctctccctgcctctttcctcacgtttctctaccactctcccccacagaacgtgaag
ctcttggaacaatttgtctgcgcccacacgggtatcatcttccatgctccatacacagga
gtctgtgtgaagcagcacaagaggttgacccaggctatccagaaagccagggatcatggt
ctcctcatttaccacatcccccaggttgaaccacgggaccttgacttcagtacctctcat
ggggctgtgagtgctactccgccagcccccaccctgatctcaggtgacccttggtaccca
tggtacaactggaaacagccaccggagagagaactgtctcgccttcgccggctttaccag
ggtcatctccgagaagagagtggccccccacctgagtcaatgcccaagatgccccctaca
acaccagcggaagcctcctccactgggcagacaggcccccagagtgctctgtag

DBGET integrated database retrieval system