KEGG   Pongo abelii (Sumatran orangutan): 100449601Help
Entry
100449601         CDS       T01416                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100449601 (ABHD12)
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100449601 (ABHD12)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100449601 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
20
AA seq 398 aa AA seqDB search
MRKRTEPVTLEHERCDAAGSSSSGSAAAALDADCRLKQNLRLTGPGAAEPRCAADAGMKR
ALGRRKGLWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVFTFDYRGWGDSMGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQ
FVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcccgtcaccttggagcatgagcgctgcgacgccgccggctcg
tcctcctccggctcggccgccgcggcgctggacgccgactgccgcctgaagcagaaccta
cgcctgacgggcccgggggcggccgagccgcgctgcgcagccgacgcgggaatgaagcgg
gcgctgggcaggcgaaagggcctgtggttgcgcctgaggaagatacttttctgtgttttg
gggttgtacattgccattccatttctcatcaaactatgtcccggaatacaggccaaactg
attttcttgaatttcgtaagggttccctatttcattgatttgaaaaaaccacaggatcaa
ggtttgaatcacacgtgtaactactacctgcagccagaggaagacgtgaccattggagtc
tggcacaccgtccctgcagtctggtggaagaacgcccaaggcaaagaccagatgtggtat
gaggatgccttggcttccagccaccctatcattctgtacctgcatgggaacgcaggtacc
agaggaggcgaccaccgcgtggagctttacaaggtgctgagttcccttggttaccatgtg
ttcacctttgactacagaggttggggtgactcgatgggaactccatctgagcggggcatg
acctatgatgcactccacgtttttgactggatcaaagcaagaagtggtgacaaccctgtg
tacatctggggccactctctgggcactggtgtggcgacaaatctggtgcggcgcctctgt
gagcgggagacgcctccagatgcccttatattggaatctccattcactaatatccgcgaa
gaagctaagagccatccattttcagtgatatatcgatacttccctgggtttgactggttc
ttccttgatcctattacaagcagtggaattaaatttgcaaatgatgaaaatgtgaagcac
atctcctgtcccctgctcatcctgcacgctgaggacgacccggtggtgcccttccagctt
ggcagaaagctctatagcatcgctgcaccagctcgaagcttccgagacttcaaagttcag
tttgtgccctttcattcagaccttggctacaggcacaaatacatttacaagagccctgag
ctgccacggatactgagggaattcctggggaagtcggagcctgagcaccagcactga

DBGET integrated database retrieval system