KEGG   Pongo abelii (Sumatran orangutan): 100449741Help
Entry
100449741         CDS       T01416                                 

Gene name
XIAP
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100449741 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100449741 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100449741 (XIAP)
  Cellular commiunity
   04510 Focal adhesion
    100449741 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100449741 (XIAP)
   05222 Small cell lung cancer
    100449741 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    100449741 (XIAP)
   05145 Toxoplasmosis
    100449741 (XIAP)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100449741 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 497 aa AA seqDB search
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPTEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLIADLVNAQKD
STQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcaataaggaa
gaagaatttgtagaagagtttaatagattaaaaacttttgctaattttccaagtggtagt
cctgtttcagcatcaacactggcacgagcagggtttctttatactggtgaaggagatacc
gtgcggtgctttagttgtcatgcagctgtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaacggcttttatcttgaaaat
agtgccacgcagtctacaaattctggtatccagaatggtcagtacaaagttgaaaactat
ctgggaagcagaaatcattttgccttagacaggccttctgagacacatgcagactatctt
ttgagaactgggcaggttgtagatatatcagacaccatatacccaaggaaccctgccatg
tatagtgaagaagctagattaaagtcctttcagaactggccagactatgctcacctaacc
ccaagagagttagcaagtgctggactctactacacaggtattggtgaccaagtgcagtgc
ttttgttgtggtggaaaactgaaaaattgggaaccttgtgatcgtgcctggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccggaatcttaatattcgaagtgaa
tctgatgctgtgagttctgataggaatttcccaaattcaacaaatcttccaagaaatcca
tccatggcagattatgaagcacggatctttacttttgggacatggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtaaagtgc
tttcactgtggaggagggctaactgattggaagcccactgaagacccttgggaacaacat
gctaaatggtatccagggtgtaaatatctgttagaacagaagggacaagaatatataaac
aatattcatttaactcattcacttgaggagtgtctggtaagaactactgagaaaacacca
tcactaactagaagaattgatgacaccatcttccaaaatcctatggtacaagaagctata
cgaatgggtttcagtttcaaggacattaagaaaataatggaggaaaaaattcagatatct
gggagcaactataaatcacttgaggttctgattgcagatctagtgaatgctcagaaagac
agtacgcaagatgagtcaagtcagacttcattacagaaagagattagtactgaagagcag
ctaaggcgcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctatc
gtttttgttccttgtggacatctagtcacttgtaaacaatgtgctgaagcagttgacaag
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system