KEGG   Pongo abelii (Sumatran orangutan): 100449795Help
Entry
100449795         CDS       T01416                                 

Gene name
ARHGAP5
Definition
(RefSeq) rho GTPase-activating protein 5 isoform X1
  KO
K13709  Rho GTPase-activating protein 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04510  Focal adhesion
pon04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100449795 (ARHGAP5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100449795 (ARHGAP5)
Membrane trafficking [BR:pon04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100449795 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP RhoGAP-FF1 Ras FF GTP_EFTU NOG1 Roc U5_2-snRNA_bdg MMR_HSR1 SR-25
Motif
Other DBs
NCBI-GeneID: 100449795
NCBI-ProteinID: XP_002824702
Ensembl: ENSPPYG00000005729
UniProt: H2NKZ7
Position
14
AA seq 1502 aa AA seqDB search
MMAKNKEPRPPSYTISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDIIQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITETDSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPSGTYPRKFNETQIKQALRGVLESVKHNLDVVSPVPANKDISEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
IHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLA
HPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDR
TSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPL
LSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYF
GMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINL
VSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPV
NYDVFRYVITHLNRVSQQHKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVET
FIQQCQFFFYNGEIVETTNIVAPPPPSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPLG
II
NT seq 4509 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgtcccccatcctataccatcagtgtagttggactc
tctgggactgaaaaagataaaggtaactgtggagttggaaagtcttgtttgtgcaataga
tttgtacgctcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccatt
gactttggaggacgagtagtaaacaatgatcactttttgtactggggtgacataatacaa
aatggtgaagatggagtagaatgcaaaattcatgtcattgaacaaacagagttcattgat
gaccagactttcttgcctcatcggagtacgaatttgcaaccatatataaaacgtgcagct
gcatctaaattgcagtcagcagaaaaactaatgtacatttgcactgatcaactaggctta
gaacaagactttgaacagaagcaaatgcctgaagggaagctcaacgtagatggattttta
ttatgcattgatgtaagtcagggatgcaataggaagtttgatgatcaacttaaatttgtg
aataacctttttgtccagttatcaaaatcaaaaaaacctgtaataatagcagcaactaaa
tgtgatgaatgcgtggatcattatcttagagaagttcaggcatttgcttcaaacaaaaag
aaccttcttgtagtggaaacatcagcacgatttaatgtcaacattgaaacatgtttcact
gcactggtacaaatgttggataaaactcgtagcaagcctaaaattattccctatttggat
gcttataaaacacagagacaacttgttgtcacagcaacagataagtttgaaaaacttgtg
cagactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatacatcaacttagagggaacaagaaaggccagaaatacattctca
aaacatatagaacaacttaaacaggaacatataagaaaaaggagagaagagtatataaat
actttaccaagagcttttaacactcttttgccaaatctagaagagattgaacatttgaat
tggtcagaagctttgaagttaatggaaaagagagcagatttccagttatgttttgtggtg
ctagaaaaaactccttgggatgaaactgaccatatagacaaaattaatgataggcggatt
ccatttgacctcctgagcactttagaagctgaaaaagtctatcagaaccatgtacagcat
ctaatatccgagaagaggagggtggaaatgaaggaaaaattcaaaaagactttggaaaaa
attcaattcatttcaccggggcagccgtgggaggaagttatgtgctttgttatggaggat
gaagccttcaaatatatcactgagactgatagcaaagaggtatatggtaggcatcagcga
gaaatagttgaaaaagccaaagaagagtttcaagaaatgctttttgagcattctgaactt
ttttatgatttagatcttaatgcaacacctagttcagataaaatgagtgaaattcataca
gttctgagtgaagaacctagatataaagctttacagaaacttgcacctgatagggaatct
cttctacttaagcatataggatttgtttatcatcccactaaagaaacatgtcttagtggc
caaaattgtacagacattaaagtggagcagttacttgctagtagtcttttacagttggat
catggccgcttaagattatatcatgatagtaccaatatagataaagttaacctttttatt
ttagggaaagatggccttgcccaagaactagcaaatgagataaggacacaatccactgat
gatgagtatgccttagatggaaaaatttatgaacttgatcttcggccggttgatgccaaa
tcgccttactttttgagtcagttatggactgccgcctttaaaccacatgggtgcttctgt
gtatttaattccattgagtcattgagttttattggggaatttattgggaaaataagaact
gaagcttctcagatcagaaaagataaatacatggctaatcttccatttacattaattctg
gctaatcagagagattccattagtaagaatctaccaattctcaggcaccaagggcagcag
ttggcaaacaagttacaatgtccttttgtagatgtaccttctggtacatatcctcgtaaa
tttaatgaaacccaaataaagcaagctctcagaggagtattggaatcagttaaacacaat
ttggatgtggtgagcccagttcctgccaataaggacatatcagaagctgacttgagaatt
gtcatgtgcgccatgtgtggagatccatttagtgtggatcttattctttcacccttcctt
gattctcattcttgcagtgctgctcaagctggacagaataattccctaatgcttgataaa
atcattggtgaaaaaaggaggcgaatacagatcacaatattatcataccactcttcaatt
ggagtaagaaaagatgaactagttcatgggtatatattagtttactctgcaaaacggaaa
gcttcaatgggaatgcttcgagcatttctatcagaagttcaagacaccattcctgtacag
ctggtggcagttactgacagccaagcagatttttttgaaaatgaggctatcaaagagtta
atgactgaaggagaacacattgcaactgagatcactgctaaatttacagcactgtattct
ttatctcagtatcatcggcaaactgaggtctttactctgttttttagtgatgttctagag
aaaaaaaatatgatagaaaattcttatttgtctgataatacaagggaatcaacccatcaa
agtgaagatgtttttctaccatctcccagagactgttttccctataataactaccctgat
tcagatgatgacacagaagcaccacctccttatagtccaattggggatgatgtacagttg
cttccaacacctagtgaccgttccagatatagattagatttggaaggaaatgagtatcct
attcatagtaccccaaactgtcatgaccatgaacgcaaccataaagtgcctccacctatt
aaacctaaaccagttgtacctaagacaaatgtgaaaaaactggatccaaaccttttaaaa
acaattgaagctggtattggtaaaaatccaagaaagcagacttcccgggtgcctttggca
catcctgaagatatggatccttcagataactatgcggaacccattgatacaattttcaaa
cagaagggctattctgatgagatttatgttgtcccagatgatagtcaaaatcgcattaaa
attcgaaactcatttgtaaataatacccaaggagacgaagaaaatggattttctgataga
acctccaaaagtcatggggaacggaggccttcaaaatacaaatataaatctaaaaccttg
tttagtaaagccaagtcatactatagaagaacacattcagatgccagtgatgatgaggct
ttcaccacttctaaaacaaaaagaaaaggaagacatcgtggaagtgaagaagatccactt
ctttctcctgttgaaacttggaaaggtggtattgataatcctgcaatcacttctgaccag
gagttagatgataagaagatgaagaagaaaacccacaaagtgaaagaagataaaaagcag
aaaaagaaaactaagaacttcaatccaccaacacgtagaaattgggaaagtaattacttt
gggatgcccctccaggatctggttacagctgagaagcccataccactatttgttgagaaa
tgtgtggaatttattgaagatacagggttatgtaccgaaggactttaccgtgtcagcgga
aacaaaactgaccaagacaatattcaaaagcagtttgatcaagatcataatatcaatcta
gtgtcaatggaagtaacagtaaatgctgtagctggagcccttaaagctttctttgcagat
ctgccagatcctttaattccatattctcttcatccagaactattggaagcagcaaaaatc
ccggataaaacagaacgtcttcatgccttgaaagaaattgttaagaaatttcatcctgta
aactatgatgtattcagatacgtgataacacatctaaacagggttagtcagcaacataaa
atcaacctaatgacagcagacaacttatccatctgtttttggccaaccttgatgagacct
gattttgaaaatcgagagtttctgtctactactaagattcatcaatctgttgttgaaaca
ttcattcagcagtgtcagtttttcttttacaatggagaaattgtagaaacgacaaacatt
gtggctcctccaccaccttcaaacccaggacagctggtggaaccaatggtaccacttcag
ttgccaccaccattgcaacctcagctgatacaaccacaattacaaacggatcctcttggt
attatatga

DBGET integrated database retrieval system