KEGG   Pongo abelii (Sumatran orangutan): 100450054Help
Entry
100450054         CDS       T01416                                 

Gene name
MAP3K2
Definition
mitogen-activated protein kinase kinase kinase 2
Orthology
K04420  
mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:pon04010]
Cellular Processes; Cell communication; Gap junction [PATH:pon04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:pon04912]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2B
AA seq 619 aa AA seqDB search
MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFP
RPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLV
INGSTQATNLEPLPSLEDLDNTVFGAERKKRLPIIGHTSRDRSSPPPGYIPDELHQVARN
GSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSY
PDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSLRSPVS
FSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGK
LLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIV
HRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR
KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKQIFVE
AKLRPSADELLRHMFVHYH
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcagcaagctttgaactcaatcatgcaagatttggctgtccttcataaggcc
agtcgaccagcattatccttgcaggaaaccagaaaagcaaaatcttcatcaccaaaaaaa
cagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatccttcagttcccc
agaccagttaaactggaagatctgagatctaaagctaaaattgcctttggacagtctatg
gatctacattataccaataacgagttggtaattccattaactactcaagatgacttggac
aaagctgtggaactgctggatcgtagtattcatatgaagagcctcaagatattacttgta
ataaatggaagtacacaggctactaatttagaaccattgccatcactagaagatttggat
aatacagtatttggtgcagagaggaaaaaacggcttcctataataggtcatactagtaga
gatagaagttctcctcccccaggatacattccagatgaattacaccaggttgcccggaat
gggtcattcactagtatcaacagtgaaggagagttcattccagagagcatggaccaaatg
ctggatccattatctttaagcagccctgaaaattctggctcaggaagttgtccatcactt
gatagtcctttggatggagagagctatccaaaatcacgaatgcctagggcacagagctac
ccagataatcatcaggaattttcagactatgataaccctatctttgagaaatttggaaaa
ggaggaacatatccaagaaggtatcatgtttcatatcatcatcaagagtataatgatggt
cgtaaaacttttccaagagctagaaggacccaggggaccagcttacggtctcctgtgagt
ttcagtcctactgatcattccttaagcactagtagtggaagcagtatctttaccccagag
tatgatgatagtcgaataagaagaaggggaagtgacatagacaatcctactttgaccgta
atggacatcagcccacccagccgttcacctcgagctccgaccaactggagattgggcaaa
ctgcttggccagggagcctttggaagggtctacctctgttatgatgttgatacaggaaga
gaattggctgttaagcaagttcaatttgatcccgacagtcctgagaccagcaaggaagta
aatgcacttgagtgtgaaattcagttgctgaaaaacttgctacatgagcgaattgttcag
tattatggctgtttgagggatccccaggaaaaaacactttccatatttatggaatatatg
ccagggggttcaattaaggaccaattaaaagcatatggcgctcttactgagaatgtgact
aggaaatacacccgtcagattctggagggtgtccattatttgcacagtaatatgattgtc
catagagatatcaaaggcgcaaatatcctgcgagattcaacaggcaacgtcaaactagga
gattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaagtct
gtcacaggcacaccatactggatgagccctgaagtcatcagtggagaaggctatggaaga
aaagcagacatctggagtgttgcatgtactgtggtagaaatgctaactgaaaagccgcct
tgggctgaatttgaagcaatggctgccatctttaaaatcgccactcagccaacaaaccca
aagctgccacctcatgtctcagactatactcgagatttcctcaaacagatttttgtagag
gccaaactgagaccttcagctgatgaactcttaaggcacatgtttgtgcattatcactag

DBGET integrated database retrieval system