KEGG   Pongo abelii (Sumatran orangutan): 100450054Help
Entry
100450054         CDS       T01416                                 

Gene name
MAP3K2
Definition
mitogen-activated protein kinase kinase kinase 2
Orthology
K04420  
mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Module
MAPK (JNK) signaling
MAPK (p38) signaling
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100450054 (MAP3K2)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100450054 (MAP3K2)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100450054 (MAP3K2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100450054 (MAP3K2)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: STE group
  STE11 family
   100450054 (MAP3K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2B
AA seq 619 aa AA seqDB search
MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFP
RPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLV
INGSTQATNLEPLPSLEDLDNTVFGAERKKRLPIIGHTSRDRSSPPPGYIPDELHQVARN
GSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSY
PDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSLRSPVS
FSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGK
LLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIV
HRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR
KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKQIFVE
AKLRPSADELLRHMFVHYH
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcagcaagctttgaactcaatcatgcaagatttggctgtccttcataaggcc
agtcgaccagcattatccttgcaggaaaccagaaaagcaaaatcttcatcaccaaaaaaa
cagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatccttcagttcccc
agaccagttaaactggaagatctgagatctaaagctaaaattgcctttggacagtctatg
gatctacattataccaataacgagttggtaattccattaactactcaagatgacttggac
aaagctgtggaactgctggatcgtagtattcatatgaagagcctcaagatattacttgta
ataaatggaagtacacaggctactaatttagaaccattgccatcactagaagatttggat
aatacagtatttggtgcagagaggaaaaaacggcttcctataataggtcatactagtaga
gatagaagttctcctcccccaggatacattccagatgaattacaccaggttgcccggaat
gggtcattcactagtatcaacagtgaaggagagttcattccagagagcatggaccaaatg
ctggatccattatctttaagcagccctgaaaattctggctcaggaagttgtccatcactt
gatagtcctttggatggagagagctatccaaaatcacgaatgcctagggcacagagctac
ccagataatcatcaggaattttcagactatgataaccctatctttgagaaatttggaaaa
ggaggaacatatccaagaaggtatcatgtttcatatcatcatcaagagtataatgatggt
cgtaaaacttttccaagagctagaaggacccaggggaccagcttacggtctcctgtgagt
ttcagtcctactgatcattccttaagcactagtagtggaagcagtatctttaccccagag
tatgatgatagtcgaataagaagaaggggaagtgacatagacaatcctactttgaccgta
atggacatcagcccacccagccgttcacctcgagctccgaccaactggagattgggcaaa
ctgcttggccagggagcctttggaagggtctacctctgttatgatgttgatacaggaaga
gaattggctgttaagcaagttcaatttgatcccgacagtcctgagaccagcaaggaagta
aatgcacttgagtgtgaaattcagttgctgaaaaacttgctacatgagcgaattgttcag
tattatggctgtttgagggatccccaggaaaaaacactttccatatttatggaatatatg
ccagggggttcaattaaggaccaattaaaagcatatggcgctcttactgagaatgtgact
aggaaatacacccgtcagattctggagggtgtccattatttgcacagtaatatgattgtc
catagagatatcaaaggcgcaaatatcctgcgagattcaacaggcaacgtcaaactagga
gattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaagtct
gtcacaggcacaccatactggatgagccctgaagtcatcagtggagaaggctatggaaga
aaagcagacatctggagtgttgcatgtactgtggtagaaatgctaactgaaaagccgcct
tgggctgaatttgaagcaatggctgccatctttaaaatcgccactcagccaacaaaccca
aagctgccacctcatgtctcagactatactcgagatttcctcaaacagatttttgtagag
gccaaactgagaccttcagctgatgaactcttaaggcacatgtttgtgcattatcactag

DBGET integrated database retrieval system