KEGG   Pongo abelii (Sumatran orangutan): 100450076Help
Entry
100450076         CDS       T01416                                 

Gene name
USP29
Definition
ubiquitin specific peptidase 29
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 912 aa AA seqDB search
MISLKVRGFIQIWSQSTGMTKLKEALIETVQRKKEIKLVVTFESGKFIRIFQLSNNIRSV
VLRHCKKRQSHLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQKKFQQPMKSDDDWNVF
ESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKRLLENQGGKGKNTLSSDLQTN
EDILKEYNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDE
TVLATQTLNAKNGLTSPLEPEHSQDDPRCNKAQVPLDSHSQQLQQGFPNLGNTCYMNAIL
QSLFAIPSFANDLLTQNVPWKYIPFEALIMTLTQLLALKDFCSTEIKRQLLGNIKKVISA
VAEIFSGNMQNDAHEFLGQCLDQLKEDMEKLNAILNTGKECGDENSSPQMHVGSAATKVF
VCPVVANFEFELQLSLICKACGHVVLKVEPNNYLSINLHQETKPLPLSVQNSLDLFFREE
ELEYNCEMCKRKSCIARHTFSRLSRVLIIHLKRYSFNNAWLLVKNNEQVYIPKYLSLSSY
CNESTKPPLPLSSSAPVGKCEVLEVSQEMISEITSPLTPSMKLTSESSDSLVLPIEPDKN
ADLQSFQRDCGEASQEQHQRDLENGSALESELVHFRDRAIGERELPGADSVMDQGDISLP
VIYEDGGKPISSPDTRLVEVHLQEVPQQPELQKYEKTNTFIEFNFDSVTESTNGFYECKE
NRIPEGSQGMTEQLQQCIEERIIEEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQKAD
LNHLGALGSDNLGNKNILDTENTRGEAKELTRNVKMGDPLQAYRLISVVSHIGSSPNSGH
YISDVYDFQKQAWFTYNDLRVSEISETKMQEARLHSGYIFFYMHNGIFEELLRKAENSRL
LSTQAGVIPHGE
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgatatctctaaaggtacgtggattcatccaaatttggagccagagcactgggatgact
aagttgaaagaagctctcattgaaacagtgcaaagaaaaaaggaaattaaactggtggtc
actttcgaatctggaaaatttataagaatttttcagctgagtaataacattagaagtgtg
gtccttagacattgtaaaaaaagacaaagtcacctgcgtttaactttgaaaaacaatgtg
ttcttgtttattgacaaattatcctacagagatgctaaacagttgaatatgttcctggac
ataatccatcaaaaaaaatttcagcaacccatgaaatctgatgatgattggaatgtgttt
gaaagcaggaatatgctgaaggaaattgacaaaacttcattttacagcatttgtaacaag
ccaagttatcagaagatgcctttgtttatgtcaaaatcaccaacacatgtgaaaaagagg
ttattagaaaatcaaggtgggaaggggaaaaacacactatcatctgatctacagacaaat
gaggacattctgaaggaatataaccctgtaccaaacaagaaatataagacagattccttg
aaatatatacaaagcaataggaagaacccatcaagtttagaggatttagaaaaagataga
gatttgaaactcgggccttcattcaataccaactgtaatggaaatcctaacctagatgag
actgttcttgcaacccagactctcaatgccaaaaatggtttgacatctccattggaacca
gagcacagccaggatgacccaagatgcaacaaagcccaggtgcctcttgactctcattca
cagcaactgcagcaagggttccccaatttgggaaacacctgttacatgaatgcaatttta
caatcgctatttgcaattccatcttttgctaatgacttactcactcaaaatgtcccatgg
aaatatattcctttcgaggctcttattatgaccttgacccagctgcttgctttgaaagat
ttctgtagtacagagatcaagagacaattacttgggaatattaaaaaagtcatttcagca
gttgcagaaatattttctggcaacatgcagaatgatgctcatgagtttttaggtcagtgt
ttagaccagctgaaagaagacatggaaaagttaaatgccattttgaatactgggaaagaa
tgtggggatgaaaattcatctccacaaatgcatgttggtagtgctgccaccaaagtgttt
gtttgccctgttgttgctaattttgagtttgaattgcagctctcccttatttgtaaagct
tgtggtcatgttgttctcaaggtagaacctaataattatctctccatcaacctgcaccaa
gaaacaaaaccacttcctttgtccgttcagaattctttagatcttttctttagagaagaa
gagcttgaatataactgtgagatgtgtaagcggaagagttgcattgcaaggcatacattt
agtaggctctccagggtccttatcattcatctgaaacgctatagcttcaacaatgcttgg
ttgctggtgaagaataacgagcaagtttatattcccaaatatttaagtttatcttcttat
tgcaatgaaagcaccaaaccacctcttcccttgagcagtagtgcacctgttgggaaatgt
gaagtcctggaagtctctcaggagatgatttctgagatcaccagcccattgacaccatca
atgaagctgacctcagaatccagtgattccctggttctacccattgaaccagacaagaat
gccgacctacaaagtttccagagagactgtggagaagcaagccaagagcagcatcagaga
gacctggaaaatggctctgcactagagtcagaattggtccactttagagacagggcaatc
ggtgaaagggagcttccaggggctgactcagtgatggaccagggagacatttctcttcct
gtgatctatgaagatggagggaagccgatcagcagcccagacacaaggcttgtcgaggtt
catcttcaagaggtgcctcaacaaccagaacttcagaagtatgagaaaaccaataccttc
atagagttcaattttgacagtgtcactgagtctaccaatggcttttatgagtgtaaagaa
aacaggattccagaaggatctcaaggaatgactgaacagctccagcagtgtattgaggag
cgcatcatagaggaatttcttcagcaggcaccacctccaggtgttaggaagctggatgcc
caagaacatacagaggagaccctcaatcagtctaccgaattaagacttcaaaaggctgac
ctgaatcaccttggggcactgggttctgacaacctaggaaacaaaaacattttagataca
gagaacacaagaggtgaagccaaggaactcacaagaaacgtgaagatgggggatcctctc
caggcctacagactcatcagtgttgtcagccatattgggagctccccaaattcaggccat
tacatcagcgatgtgtatgactttcagaagcaggcctggttcacatacaatgatctacgt
gtatcagaaatctcagagaccaaaatgcaggaggcgaggcttcactctgggtatatcttc
ttttacatgcacaatgggatttttgaggagctgttaagaaaagcagagaactctcggcta
cttagcacacaggcaggggtgatccctcatggggaataa

DBGET integrated database retrieval system