KEGG   Pongo abelii (Sumatran orangutan): 100450082Help
Entry
100450082         CDS       T01416                                 

Gene name
CLTCL1
Definition
clathrin, heavy chain-like 1
Orthology
K04646  
clathrin heavy chain
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pon04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:pon04142]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:pon04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:pon04721]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:pon05016]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:pon05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 1640 aa AA seqDB search
MAQILPIRFQEHFQLQNLGINPANVGFSTLTMESDKFICIREKVGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLAGCQVIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVRKAVDVFFPPEAQNDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCIYMNRISA
DTIFVTAPHKPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAVRSNLAGA
EKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQSGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRDVMKISPEQGLQFSQMLVQDE
EPLANISQIVDIFMENSLIQQCTSFLLDALKNNRPTEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLHAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYEGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYRNNLQRYIEIYVQKVNPSRTPAVTGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESRIQEGCEEPATHNALAKIYIDSNNSPECFLRQNAYY
DSSVVGRYCEKRDPHLACVAYERGQCDLELLKVCNENSLFKSEARYLVRRKDPELWAYVL
EETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADCTRVMEYISRLDNYDALDIASIAVSSALYEEAFTVFHKFDMNAS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLAQAQLQKDLVKEAIDSYVRGDDPSSYLEV
VQAASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTSRLSELEDFINGPNNAHIQQ
VGDRCYEEGMYEAAKLLYSNVSNFARLASTLVHLGEYQAAVDNSRKASSTRTWKEVCFAC
VDGQEFRFAQLCGLHIVIHADELEELMCYYQDRGYFEELISLLEVTLGLERAHMGMFTEL
AILYSKFKPQKMLEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMMS
HPTEAWKEGQFKDIITKVANVELCYRALQFYLDYKPLLINDLLLVLSPRLDHTRTVSFFS
KAGQLPLVKPYLRSVQSHNNKSVNEAFNHLLTEEEDYQGLRASIDAYDNFDNISLAQRLE
KHQLMEFRRIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEE
GKRECFAACLFTCYDLLRPDMVLELAWRHNLVDLAMPYFIQVMREYLSKVDKLDALESLR
KQEEHVTEPAPLMFDFDGHE
NT seq 4923 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaatcctccctattcgctttcaggagcacttccagctccaaaaccttggaatt
aatccagctaacgttggattcagcacactgaccatggaatctgacaagttcatatgtatc
cgagagaaagttggtgagcaggcacaggtcacgatcattgacatgagtgacccaatggct
ccgatccgacggcctatctctgcagagagtgccatcatgaatccagcctctaaggtgata
gctctgaaagctgggaagacacttcagatctttaatattgagatgaagagtaaaatgaag
gctcatactatggcagaagaggtgattttctggaaatgggtttctgtgaacactgttgcc
ttggtgaccgagaccgcggtctaccactggagcatggaaggtgactcccagcccatgaag
atgtttgacagacataccagtctggcgggctgccaggtgattcactaccggactgatgag
taccagaagtggctgctcctcgtaggcatctcggctcagcaaaaccgtgtggttggagca
atgcagctctactctgtggataggaaggtttcacaacccatagaaggccatgccgcggct
tttgcagagttcaagatggaggggaatgccaagcctgccacccttttctgctttgctgta
cgtaatcccacaggaggcaagttgcacatcattgaagttggacagcctgcagcgggaaac
caaccttttgtaaggaaagcagtagatgtgttttttcctccagaggcacagaatgatttt
ccagtggctatgcagattggagctaaacatggtgttatttacttgatcacaaagtatggc
tatcttcatctgtatgacctagagtctggcgtgtgcatctacatgaaccgtattagtgct
gacacaatatttgtcactgctccacacaaaccaacctctggaattattggtgtcaacaaa
aagggacaggtgctgtcagtttgtgttgaggaagataacattgtgaattatgcaaccaac
gtgcttcagaatccagaccttggtctgcgtttggccgttcgtagtaacctggctggggca
gagaagttgtttgtgagaaaattcaataccctctttgcacagggcagctatgctgaagcc
gccaaagttgcagcgtctgcaccaaagggaatcctgcgtaccagagagacggtccagaaa
ttccagagtatacccgctcagtctggccaggcttctccattgctgcagtactttggaatc
ctgctcgaccagggtcagctcaataaacttgaatccttagaactttgccacctggttctt
cagcaggggcgtaagcaactcctagagaagtggctgaaagaagataagctggagtgctca
gaggagctcggagacttggtcaaaaccactgaccccatgctcgctctgagtgtgtacctt
cgggcaaacgtgccaagcaaagtgatccagtgttttgcagaaacaggccaattccagaaa
attgtgctctatgccaaaaaggttgggtacaccccagactggatctttctgctgagggat
gtaatgaagatcagtccggaacagggcctgcagttttctcaaatgctagtgcaggacgag
gagccgctggccaacattagccagattgtggacattttcatggaaaacagtttaattcag
cagtgtacttccttcttattggatgccttgaagaataatcgcccaactgagggactcctc
cagacatggctgttggagatgaaccttgttcatgcaccccaggttgcagatgccatcctt
ggaaataaaatgtttactcattacgaccgggcccacattgcccagctctgtgagaaggca
ggcctcctgcagcaagcactggagcactacactgacctctatgacatcaagagggctgtg
gtccacactcacctcctcaatcccgagtggcttgtcaatttctttggctccttatcggtg
gaggattctgtggagtgtctgcatgccatgctgtctgctaacatcagacagaaccttcag
ctgtgtgtgcaggtggcctctaagtaccatgagcagctgggcacgcaggccctggtggag
ctctttgaatccttcaagagttatgaaggcctcttctacttcctgggctcaattgtgaac
ttcagccaagacccagatgtgcatctgaaatacattcaggctgcctgtaagacagggcag
atcaaggaggtggagaggatatgccgagagagcagctgctacaacccagagcgtgtgaag
aacttcctgaaggaggccaagctcacagaccagcttcccctcatcatcgtgtgtgatcgt
tttggctttgtccatgaccttgtcctgtatttataccgcaacaacctgcagaggtacatt
gagatctacgtgcagaaggtcaaccctagccggaccccagctgtgactggagggctgctt
gatgtggattgctctgaggaagtgattaaacacttaatcatggcagtgagaggacagttc
tctactgatgagttggtggctgaagtagaaaaaagaaataggctcaagctgctgcttccc
tggctggagtcccggattcaggaaggctgtgaggagcctgccactcataatgcactggct
aaaatctacatcgacagcaacaacagccccgagtgcttcctgagacagaatgcctactat
gacagcagcgtggtgggccgctactgtgagaaacgagacccccatctggcctgtgtcgcc
tatgagcgggggcagtgtgaccttgagctcctcaaggtgtgcaatgagaattctctgttc
aaaagcgaggcccgctacctggtacgcagaaaggatccggagctctgggcttacgtcctt
gaggagaccaacccatctaggagacagctaattgaccaggtggtacagacagcattgtca
gaaacacgagatcctgaagagatttcggtcactgtcaaagcctttatgacagccgacctg
cctaatgaactgattgaactgctggagaagatagttctggataactctgtcttcagcgag
cacaggaatctacagaatctgttgatcctgactgccatcaaggcagactgcacacgggtc
atggagtacatcagccgcctggacaactatgacgcactggacatcgcgagcatcgctgtc
agcagcgcgctgtatgaggaggccttcaccgtcttccacaagtttgatatgaatgcctca
gcaatccaggtcctgatcgagcacattggaaacctggaccgggcatatgagtttgcggag
agatgcaatgagcctgctgtgtggagtcagctggcccaagcccagctccagaaagatttg
gtgaaggaagccatcgactcctatgtcagaggggacgacccttcctcttacctggaagtt
gttcaggcagccagcaggagcaacaactgggaggatctagttaaatttctgcagatggcc
aggaaaaagggccgtgagtcctatatagagactgaacttatttttgccttggctaaaacc
agccgtctttctgagctagaagattttattaatggacccaacaatgcccacatccagcag
gttggagaccgctgttacgaggagggaatgtacgaggctgccaagctgctctatagcaat
gtttctaactttgcccgcctggcttccaccttggttcacctcggtgagtatcaggcagca
gtggacaacagccgcaaggccagcagcacccggacgtggaaggaggtgtgctttgcctgc
gtggatggacaggagttccgctttgcacagctgtgtggtcttcacatcgtcattcatgca
gatgagctggaggagctgatgtgctattaccaggatcgtggctactttgaggagctgatc
tcgctgttggaggtgaccctgggcctggagcgggcccatatgggcatgttcacagagctg
gccatcctctactccaaattcaagccacagaagatgctggagcatctggagcttttctgg
tcccgtgtcaacatcccaaaggtgctgagggctgcagagcaggcacacctgtgggctgag
ctggtgttcctctatgacaagtacgaggagtacgacaatgctgtgctcaccatgatgagc
caccccactgaggcttggaaggagggtcagttcaaggacatcattaccaaggttgccaac
gtcgagctctgttacagagccctgcagttctatttggattacaaaccactgctcatcaat
gacctgctgctggtgctgtcaccccggctggaccacacccggacagtcagtttcttttca
aaggcaggtcagctgcccctggtgaagccttacctgcggtcagtccagagccacaacaac
aagagtgtgaatgaggcattcaaccacctgctgacagaggaggaggactatcagggctta
agggcatctatcgatgcctatgacaactttgacaacatcagcctggctcagcggctggag
aagcatcagctgatggagttcaggcgcattgcggcctatttgtacaagggcaataactgg
tgggcccagagcgtggagctctgcaagaaggatcatctctacaaggatgccatgcagcat
gccgcagagtcgcgggatgccgagctggcccagaagttgctgcagtggttcctggaggaa
ggcaagagggagtgcttcgcagcctgtctcttcacctgctatgacctgcttcgcccagac
atggtgcttgagctggcttggaggcacaacctcgtggacttggccatgccctacttcatt
caggtgatgagggagtacctgagcaaggtggacaaactggatgccttggagagtctgcgc
aagcaagaggagcatgtgacagagcctgcccctctcatgtttgattttgatgggcatgaa
tga

DBGET integrated database retrieval system