KEGG   Pongo abelii (Sumatran orangutan): 100450988Help
Entry
100450988         CDS       T01416                                 

Definition
dual specificity mitogen-activated protein kinase kinase 2-like
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Gap junction
Signaling pathways regulating pluripotency of stem cells
Toll-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Prion diseases
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100450988
   04015 Rap1 signaling pathway
    100450988
   04010 MAPK signaling pathway
    100450988
   04012 ErbB signaling pathway
    100450988
   04370 VEGF signaling pathway
    100450988
   04066 HIF-1 signaling pathway
    100450988
   04068 FoxO signaling pathway
    100450988
   04024 cAMP signaling pathway
    100450988
   04022 cGMP - PKG signaling pathway
    100450988
   04151 PI3K-Akt signaling pathway
    100450988
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100450988
  Cellular commiunity
   04540 Gap junction
    100450988
   04550 Signaling pathways regulating pluripotency of stem cells
    100450988
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100450988
   04650 Natural killer cell mediated cytotoxicity
    100450988
   04660 T cell receptor signaling pathway
    100450988
   04662 B cell receptor signaling pathway
    100450988
   04664 Fc epsilon RI signaling pathway
    100450988
  Endocrine system
   04910 Insulin signaling pathway
    100450988
   04912 GnRH signaling pathway
    100450988
   04915 Estrogen signaling pathway
    100450988
   04917 Prolactin signaling pathway
    100450988
   04921 Oxytocin signaling pathway
    100450988
   04919 Thyroid hormone signaling pathway
    100450988
   04916 Melanogenesis
    100450988
  Circulatory system
   04270 Vascular smooth muscle contraction
    100450988
  Nervous system
   04720 Long-term potentiation
    100450988
   04730 Long-term depression
    100450988
   04722 Neurotrophin signaling pathway
    100450988
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100450988
   05206 MicroRNAs in cancer
    100450988
   05205 Proteoglycans in cancer
    100450988
   05214 Glioma
    100450988
   05216 Thyroid cancer
    100450988
   05221 Acute myeloid leukemia
    100450988
   05220 Chronic myeloid leukemia
    100450988
   05218 Melanoma
    100450988
   05211 Renal cell carcinoma
    100450988
   05219 Bladder cancer
    100450988
   05215 Prostate cancer
    100450988
   05213 Endometrial cancer
    100450988
   05223 Non-small cell lung cancer
    100450988
  Neurodegenerative diseases
   05020 Prion diseases
    100450988
  Infectious diseases
   05164 Influenza A
    100450988
   05161 Hepatitis B
    100450988
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100450988
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100450988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 331 aa AA seqDB search
AGLGETASFSGTLRTSCLEALSTVPGTPDAALQADVGKLSSPAYSRAVLRGLAYLREKHQ
IMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSD
IWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVVDGEEGEPHSISPRPRPPGRPISGHG
MDSRPAMTGLGLGLGGKMMTEPDGVALVTQLSLHLAATPTPGEHIPPLLPRLFPPLPLCG
KGLTLPCWHHLHGRSHSGDPPPKLPNGVFTPDFQEFVNKCLIKNPAERADLKMLTNHTFI
KRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
NT seq 997 nt NT seq  +upstreamnt  +downstreamnt
ggcgggcctaggggaaacggcgtccttctcgggcacccttagaacatcctgtctggaggc
ccttagcacagtccctgggaccccagatgctgcccttcaggctgatgtgggcaaactcag
cagcccagcctactcccgggccgttctccggggcttggcgtacctccgagagaagcacca
gatcatgcaccgagatgtgaagccctccaacatcctcgtgaactctagaggggagatcaa
gctgtgtgactttggggtgagcggccagctcatcgactccatggccaactccttcgtggg
cacgcgctcctacatggctccggagcggttgcagggcacacattactcggtgcagtcgga
catctggagcatgggcctgtccctggtggagctggccatcggaaggtaccccatcccccc
gcccgacgccaaggagctggaggccatctttggccggcccgtggtcgacggggaagaagg
agagcctcacagcatctcgcctcggccgaggccccccgggcgccccatcagcggtcacgg
gatggacagccggcccgccatgactgggctaggcctggggttgggtggcaagatgatgac
ggagccagatggggtggccctggtgacccagctctccctgcacctagcagccacacccac
gcccggtgagcacatccccccactgctcccccgcctcttcccgcccctgcccctgtgcgg
gaaaggcctgaccctgccctgctggcaccacttacacggccgctcccactccggggaccc
acctcctaagctgcccaacggggtgttcacccccgacttccaggagtttgtcaataaatg
cctcatcaagaacccagcggagcgggcggacctgaagatgctcacaaaccacaccttcat
caagcggtccgaggtggaagaagtggattttgctggctggttgtgtaaaaccctgcggct
gaaccagcccggcacacccacgcgcaccgctgtgtga

DBGET integrated database retrieval system