KEGG   Pongo abelii (Sumatran orangutan): 100451021Help
Entry
100451021         CDS       T01416                                 

Definition
liver carboxylesterase 1-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100451021
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100451021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 566 aa AA seqDB search
MWLPALVLGTVAASTVWGHLSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL
GSLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQFLSELLTNRKENVPLKISEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGRVLAAHENVVVVTIQHRLGIWGFFST
GDEHSRGNWGHLDQLAALHWVQDNIASFGGNPGSVTIFGESSGAESVSVLIFSPLSKNLF
HRAISESGVALTPALVDEGDIKPLAKQIANTAGCETTTSAVMVHCLRQKTEEELLETTLK
MNFLTLDLHGDPRKSYPHTPTVIDGVVLPKTPEELQAEGKFHTVPYIVGFNRKEFGWFLP
TLMSYPLSEGKLDQKTAMSLLWKSYPLVHIPKELIPEAIEKYLGGTDDPVKKKDLFLDLM
GDVLFCVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFL
KEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPAYNQKEEYLQIGANTQAAQKLKD
KEVAFWTNLFAKKAVEKPPQTEHIEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccctgctcttgtcctgggcactgtcgccgcttccacggtttgggggcatctg
tcatcgccacctgtggtggacaccgtgcatggcaaagtgttggggaagttcgtcagctta
gaaggatttgcacagcctgtggccatttttctgggaatcccttttgccaagccccctctt
ggatccctgaggtttactccaccacagcctgcagaaccgtggagcttcgtgaagaatgcc
acctcgtaccctcctatgtgcacccaagatcccaaggcggggcagtttctctcagagcta
ttgaccaacagaaaggagaacgttcctctcaagatttccgaagactgtctttacctcaat
atttacactcctgctgacttgaccaagaaaaacaggctgccggtgatggtgtggatccat
ggaggggggctgatggtgggcgcagcatcaacctatgatgggcgggtcctcgctgcccat
gaaaacgtggtggtggtgaccattcagcaccgcctgggcatctggggattctttagcaca
ggagatgaacacagccgggggaattggggtcacctggaccagctggctgccctgcactgg
gtccaggacaacattgccagcttcggaggaaacccaggctctgtgaccatctttggagag
tcatcgggagcagaaagtgtttctgttcttattttctctccattgtccaagaatctcttc
caccgggccatttctgagagtggtgtggccctcactcctgccctggtggacgagggtgac
atcaagcccctggctaagcaaattgctaacactgctgggtgtgaaaccaccacctcagct
gtcatggttcactgcctgcgacagaagacggaagaggagctcttggagaccacattgaaa
atgaatttcttaactctggacttacatggagaccccagaaagagttacccccacacgccc
acggtgattgatggagtggtgctgccaaaaacacccgaggagcttcaagctgaagggaag
ttccacactgtcccctacatcgtcggatttaacaggaaggagtttggctggtttcttcca
acgttgatgagctatccactctccgaagggaaactggaccagaagacagccatgtcactc
ttgtggaagtcctaccccttggttcacattcctaaggaactgattccagaagccattgag
aagtacttaggaggaacagacgaccctgtcaaaaagaaagacctgttcctggacttaatg
ggggacgtgttgttctgtgtcccatctgtgattgtggcccgaaaccacagagatgctgga
gcgccaacctacatgtatgagtttcagtatcgtccaagcttctcatcagacatgaaaccc
aagacggtgataggagaccatggggatgagctcttctccgtctttggggccccattttta
aaagagggtgcctcagaagaggagatcagacttagcaagatggtgatgaaattctgggcc
aactttgctcgcaatggaaaccccaatggggaagggctgccccactggccagcgtacaac
cagaaggaagagtatctgcagattggtgccaacacccaggcggcccagaagctgaaggac
aaagaagtagctttctggaccaacctctttgccaagaaggcagtggagaagccaccccag
acagaacacatagagctgtga

DBGET integrated database retrieval system