KEGG   Pongo abelii (Sumatran orangutan): 100451029Help
Entry
100451029         CDS       T01416                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100451029 (MAPK7)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100451029 (MAPK7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100451029 (MAPK7)
   04921 Oxytocin signaling pathway
    100451029 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    100451029 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100451029 (MAPK7)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100451029 (MAPK7)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100451029 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 814 aa AA seqDB search
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPASEPTPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPTSVPAPAPVPTPTPAQP
TSPPPGPVAQPTGPQPQPAGSTSGPVPQPACPPPGPAPHPTGTPGPIPVPAPPQIATSTS
LLAPQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAAGAPQSSMSESPDVNLVTQQLSKSQV
EDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADAPQDGQADSASLSASLLADWL
EGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgccttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaagcacgacaacatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagcgacctccaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcttgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccttccaacctattggtgaatgagaactgtgagctgaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgactgag
tatgtggccacgcgctggtaccgtgcacccgagctcatgctctctttgcatgagtataca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaactacgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagctgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcttttgaccgtgaagccctcactcgggagcgcattaaggaggcc
attgtggctgaaattgaggacttccatgcaaggcgtgagggcatccgccaacagatccgc
ttccagccttctctacagcctgtggctagtgagcctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctccaccaccagccccgccaccg
tgccccggccctgcacctgacaccattgatctgaccctgcagccacccccaccagccagt
gagcctaccccaccgaagaaagagggtgccatctcagacaatactaaggctgcccttaaa
gctgccctgctcaagtctttgaggagccggctcagagatggccccagcgcacccctggag
gctcctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggaggcggcaagaacgagccaaggagcgggagaaacggcggcaggagcgggagcga
aaggaacggggggctggggcctctgggggcccctccactgaccccttggctggactagtg
ctcagtgacaatgacagaagcctgttggaacgctggactcgaatggcccggcccccagcc
ccagcccccacctctgtgccggcccctgccccagtgccaacgccaaccccagcccaacct
accagtcctcctcctggccctgtagcccagcccactggcccgcaaccacaacctgcgggc
tctacctctggccctgtaccccagcctgcctgcccaccccctggccctgcaccccacccc
actggcactcctgggcccatccctgtccctgcgccaccccagattgccacctccaccagc
ctcctggctccccagtcccttgtgccaccccctgggctgcctggctccagcaccccagga
gttttgccttacttcccacctggcctgccacctccagacgccgcgggagcccctcagtct
tccatgtcagagtcacctgatgtcaatcttgtgacccagcagctatctaagtcacaggtg
gaggacccactgccccccgtgttctcaggcacaccaaagggcagtggggctggctacggt
gttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggctgatgcg
ccacaggatggccaggcagattcagcctctctctcagcctccctgcttgctgactggctc
gaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccagatggac
tccccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system