KEGG   Pongo abelii (Sumatran orangutan): 100451264Help
Entry
100451264         CDS       T01416                                 

Gene name
LYZ
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Salivary secretion
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:pon04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 148 aa AA seqDB search
MKALIILGLVLLSVTVQSKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNPGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattattctggggcttgtcctcctttctgttacagtccagagcaaggtc
tttgaaaggtgtgagttggccagaactctgaaaagattgggaatggatggctacagggga
atcagcctagcaaactggatgtgtttggccaaatgggagagtggttataacacacgagct
acaaactacaatcctggagacagaagcactgattatgggatatttcagatcaatagccgc
tactggtgtaatgatggcaaaaccccaggagcagttaatgcctgtcatttatcctgcagt
gctttgctgcaagataacatcgctgatgctgtagcttgtgcaaagagggttgtccgtgat
ccacaaggcattagagcatgggtggcatggagaaatcgttgtcaaaacagagatgtccgt
cagtatgttcaaggttgtggagtataa

DBGET integrated database retrieval system