KEGG   Pongo abelii (Sumatran orangutan): 100451530Help
Entry
100451530         CDS       T01416                                 

Definition
protein unc-13 homolog C-like
Orthology
K15293  
protein unc-13
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:pon04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 1674 aa AA seqDB search
MVSNFFKSLILPYIHKLCKGMFTKKLGNTNKNEEYRQQKKDQEFPTAGQTKSPKFSYTFK
STVKKIAKCSSTHNLSTEEEEASKEFSLSPTFSYRVAIANGLQKNTKVTNSDNEDLLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHGLKLGA
LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTVRNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVPEERFEYVESVVYQILIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKEKG
IPSSQTYESMDIKLSTPEPKIKKNNWQSPDDSDEDLESDLNRNSYAVLPKSELLTKGSIS
KPSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYES
PKDQHLNGSVQGIQGQTEIENTETVDSGMSNGMVCASGDQSHYGDSQLSLHEDLSPWKEW
NQGEQGADLGLDSSTQEGFDYETNSLSDQQLGVYSKDLEYLGKCHSDLQDDSESYDLTQD
DNSSPCPGLDNEPQGQWVGQYDSYQGANSNELYQNQNQLSMMYQSQSELQSDDSEDAPPK
SWHSRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLS
QSTANESSTTLDSEVYTEPYYYKAENEEDYTEPVADNETDYVEVMEQVLAKLENRSSITE
TDEQMQAYDHLLYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMEIREDENQNIPE
QPVEITKPKRIRPSFKEAALRAYKKQMAELEEKIMAGDSSSVDEKARISGNDLDASKFSA
LQVCGGAGGGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKM
HVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEK
CQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKE
DFVQFTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKT
IFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRT
LSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVK
SNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVP
AVMSTLLANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYR
ENFPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIF
DNCHELYSQLTDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPILNQFP
QELNMGKISAEIMWTLFALDMKYALEGNYKYLYLFKYMLELNGDIVFLALNVKN
NT seq 5025 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctaattttttcaagagcttgattttaccttacattcataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaacaaaaacgaagagtatcgtcagcagaaaaag
gatcaagagttccccactgctggccagaccaaatcccccaaattttcttatacctttaaa
agcactgtaaagaagattgcaaagtgttcatccactcacaacttatccactgaggaagag
gaggctagtaaagagttttccctctcaccaacattcagttaccgagtagctattgccaat
ggcctacaaaagaatactaaagtaaccaacagtgataatgaggatttgcttcaagagctc
tcttcaattgagagttcctactcagaatcattaaatgaactaaggagtagcacagaaaac
caggcacaatcaacacacacaatgccagttagacgcaacagaaagagttcaagcagcctt
gcaccctctgagggcagctctgacggggagcgtactctacatggcttaaaactgggagct
ttacgaaaactgagaaaatggaaaaagagtcaagagtgtgtctcctcagactcagagtta
agcaccatgaaaaaatcttggggaataagaagcaagtctttggaccgaactgtccgaaac
ccaaagacaaatgccctggagccagggttcagttcttctggctgcattagccaaacacat
gatgtcatggaaatgatctttaaggaacttcagggaataagtcagattgaaacagaactt
tctgaactacgagggcatgtcaatgctctcaagcactccatcgatgagatctccagcagt
gtggaggttgtacaaagtgaaattgagcagctacgtacagggtttgtccagtctcggagg
gaaactagagacatccatgattatattaagcacttaggtcatatgggtagcaaggcaagc
ctgagatttttaaacgtgcctgaagaaagatttgaatatgttgaaagtgtggtataccaa
attctaatagataaaatgggtttttcagatgcaccaaatgctattaaaattgaatttgct
cagaggataggacaccagagggactgcccaaatgcaaagcctcgacccatacttgtgtac
tttgaaacccctcagcaaagggattctgtcttaaaaaaatcatataaactcaaaggaaca
ggcattggtatctcaacagatattctaactcatgacatcagagaaagaaaagagaaaggg
ataccatcctcccagacatatgagagcatggatataaagttgtctactccagagccaaaa
atcaagaagaacaattggcagtcacctgatgacagtgatgaagatcttgaatctgacctc
aatagaaatagttacgctgtgcttcccaagtcagagcttctaacaaagggaagtatttcc
aagccaagctcaaaatcacacagtgctagatccaagaataaaactgctaatagcagcaga
atttcaaataaatcagattatgataaaatctcctcgcagttgccagaatcagatatcttg
gaaaagcaaaccacaacccattatgcagatgcaacacctctctggcactcacagagtgat
tttttcactgctaaacttagtcgttctgaatcagatttttccaaattgtgtcagtcttac
tcagaggatttttcagaaaatcagtttttcactagaactaatggaagctctctcctgtca
tcttcggaccgggagctatggcagaggaaacaggaaggaacagcgaccctgtatgagagt
cccaaggaccagcatttgaatggaagtgttcagggtatccaagggcagactgaaattgaa
aacacagaaactgtggatagtggaatgagtaatggcatggtgtgtgcatctggagaccag
agtcattacggtgattctcagctctctttacatgaggatctttctccatggaaggaatgg
aatcaaggagagcaaggagctgatttaggcttggattcatccacccaggaaggttttgat
tatgaaacaaacagtctttctgaccaacagcttggtgtttacagtaaagacctagaatac
ttgggaaagtgccacagtgatcttcaagatgactcagagagctatgacttaactcaagat
gacaattcttctccatgccctggcttggataatgaaccacaaggccagtgggttggccag
tatgattcttatcagggagctaattctaatgagctataccaaaatcaaaaccagttgtcc
atgatgtatcaaagtcaaagtgaattgcaaagtgatgactctgaggatgccccacccaaa
tcatggcatagtcgattaagcattgacctttctgataagactttcagcttcccaaaattt
ggatctacactgcagagggctaaatcagccttggaagtagtatggaacaaaagcacacag
agtctgagtgggtatgaggacagtggctcttcattaatggggagatttcggacattatct
caatcaactgcaaatgagtcaagtaccacacttgactctgaggtctacacggagccctat
tactataaagcagagaatgaggaagattatactgaaccagtggctgataatgaaacagat
tatgttgaagtgatggaacaagtccttgctaaactagaaaacaggagtagtattactgaa
acagatgaacaaatgcaagcatatgatcaccttttgtatgaaacaccttatgaaacccca
caagatgagggttatgatggtccagcagatgatatggttagtgaagagggattagaaccc
ttaaatgaaacatcagctgagatggaaataagagaagatgaaaaccaaaacattcctgaa
cagccagtggagatcacaaagccaaagagaattcgtccttctttcaaagaagcagcttta
agggcctataaaaagcaaatggcggagttggaagagaagatcatggctggagatagcagt
tctgtggatgaaaaggctcgaataagtggcaatgatttggatgcttccaaattttctgca
ctccaggtgtgtggtggggctggaggtggactttatggtattgacagcatgccggatctt
cgcagaaagaaaactttgcctattgtccgagatgtggccatgaccctggctgcccggaaa
tctggactctccctggctatggtgattaggacatccctaaataatgaggaactgaaaatg
cacgtcttcaagaagaccttgcaggcactgatctaccctatgtcttctaccaccccacac
aattttgaggtctggacggctaccacgcccacctactgttatgagtgtgaagggctcctg
tggggcattgcaaggcaaggcatgaagtgtctggagtgtggagtgaaatgccacgaaaag
tgtcaggacctgctaaatgctgactgcttgcagagagcagcagaaaagagttctaaacat
ggtgccgaagacaagactcagaccattattacagcaatgaaagaaagaatgaagatcagg
gagaaaaaccggccagaagtatttgaagtaatccaggaaatgtttcagatttctaaagaa
gattttgtgcagtttacaaaggcggccaaacagagtgtactggatgggacatctaagtgg
tctgcaaaaataaccattacagtggtttctgcacagggtctacaggcaaaagataaaaca
gggtctagtgatccatatgttacagttcaagttggaaagaacaaaagaagaacaaaaacc
atttttggaaatttgaatccagtatgggatgagaagttttattttgagtgtcataactcc
acagatcgaatcaaagtcagagtatgggatgaagatgatgatattaaatccagagtcaag
caacatttcaaaaaggagtcagatgattttctgggacaaacaattgtagaagtgaggacc
ttgagtggagaaatggatgtctggtacaacttagagaaaaggacagataagtcagctgta
tctggggccatacgattgaaaatcaatgtggagataaaaggagaagagaaggttgctcca
tatcatattcaatatacatgtttacatgagaatctgttccattacttgactgaagtgaaa
tctaatggtggagtgaaaatcccagaagtcaaaggggatgaagcctggaaggttttcttt
gatgatgcttcccaagaaatagttgatgagtttgctatgcgttatggaattgaatccatt
tatcaagctatgacgcacttttcatgtctgtcttctaaatacatgtgccccggtgtccct
gccgtcatgagcaccttgctggctaatataaatgctttttatgctcacacaacagtttca
acaaatgtacaggtttctgcctcagatcgatttgctgctaccaactttggtagggaaaaa
ttcataaaactgctggaccagttacataactctttgaggattgatctgtcaaagtatagg
gaaaactttcctgcaagcaatactgaaagactgcaagacctgaaatcaactgttgacctg
ttaacaagtatcaccttttttaggatgaaggttctggagctgcaaagccccccaaaagcg
agcatggtggtgaaggactgtgtaagagcttgcctggattctacatacaagtatattttt
gacaattgccatgaactctattcccaactaacggacccgagtaagaaacaggatattcct
cgtgaagatcagggaccaaccaccaagaatttggatttttggccccaacttattacactg
atggttactattattgatgaggataaaactgcctacacacctatcctgaatcagtttcct
caagagctgaacatgggaaaaataagtgccgaaattatgtggactctttttgctctggat
atgaaatatgcattagaaggtaattataaatatttatacttattcaaatacatgttagag
ttaaatggtgatattgtgttcttggctttaaatgttaagaattga

DBGET integrated database retrieval system