KEGG   Pongo abelii (Sumatran orangutan): 100451530Help
Entry
100451530         CDS       T01416                                 

Gene name
UNC13C
Definition
(RefSeq) protein unc-13 homolog C isoform X1
  KO
K15293  protein unc-13 A/B/C
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100451530 (UNC13C)
Membrane trafficking [BR:pon04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100451530 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Membr_traf_MHD C2 DUF1041 C1_1 DUF2205 Med9 FCH
Motif
Other DBs
NCBI-GeneID: 100451530
NCBI-ProteinID: XP_002825517
Position
15
AA seq 2216 aa AA seqDB search
MVSNFFKSLILPYIHKLCKGMFTKKLGNTNKNEEYRQQKKDQEFPTAGQTKSPKFSYTFK
STVKKIAKCSSTHNLSTEEEEASKEFSLSPTFSYRVAIANGLQKNTKVTNSDNEDLLQEL
SSIESSYSESLNELRSGTENQAQSAHTMPVRRNRKSSSSLAPSEGSSDGERTLHGLKLGA
LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTVRNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVPEERFEYVESVVYQILIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKEKG
IPSSQTYESMDIKLSTPEPKIKKNNWQSPDDSDEDLESDLNRNSYAVLPKSELLTKGSIS
KPSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYES
PKDQHLNGSVQGIQGQTEIENTETVDSGMSNGMVCASGDQSHYGDSQLSLHEDLSPWKEW
NQGEQGADLGLDSSTQEGFDYETNSLSDQQLGVYSKDLEYLGKCHSDLQDDSESYDLTQD
DNSSPCPGLDNEPQGQWVGQYDSYQGANSNELYQNQNQLSMMYQSQSELQSDDSEDAPPK
SWHSRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLS
QSTANESSTTLDSEVYTEPYYYKAENEEDYTEPVADNETDYVEVMEQVLAKLENRSSITE
TDEQMQAYDHLLYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMEIREDENQNIPE
QPVEITKPKRIRPSFKEAALRAYKKQMAELEEKIMAGDSSSVDEKARISGNDLDASKFSA
LQVCGGAGGGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKM
HVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEK
CQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKE
DFVQFTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKT
IFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRT
LSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVK
SNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVP
AVMSTLLANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYR
ENFPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIF
DNCHELYSQLTDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPILNQFP
QELNMGKISAEIMWTLFALDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELPAF
KDAVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVFA
QLNQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSYCDKENVPCILM
NNIQQLRVQLEKMFESMGGKELDSEASTILKELQVKLSGVLDELSVTYGESFQVIIEECI
KQMSFELNQMRANGNTTSNKNSAAMDAEIVLRSLMDFLDKTLSISAKICEKTVLKRVLKE
LWKLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDAKGLTPRQCAIM
EVVLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSRS
SKDAVGQISVHVDITATPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDKK
RKQGTKTKSNTWSPKYNETFQFILGKENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQN
IAEKGSYGAWYPLLKNISMDETGLTILRILSQRTSDDVAKEFVRLKSETRSTEENA
NT seq 6651 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctaattttttcaagagcttgattttaccttacattcataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaacaaaaacgaagagtatcgtcagcagaaaaag
gatcaagagttccccactgctggccagaccaaatcccccaaattttcttatacctttaaa
agcactgtaaagaagattgcaaagtgttcatccactcacaacttatccactgaggaagag
gaggctagtaaagagttttccctctcaccaacattcagttaccgagtagctattgccaat
ggcctacaaaagaatactaaagtaaccaacagtgataatgaggatttgcttcaagagctc
tcttcaattgagagttcctactcagaatcattaaatgaactaaggagtggcacagaaaac
caggcacaatcagcacacacaatgccagttagacgcaacagaaagagttcaagcagcctt
gcaccctctgagggcagctctgacggggagcgtactctacatggcttaaaactgggagct
ttacgaaaactgagaaaatggaaaaagagtcaagagtgtgtctcctcagactcagagtta
agcaccatgaaaaaatcttggggaataagaagcaagtctttggaccgaactgtccgaaac
ccaaagacaaatgccctggagccagggttcagttcttctggctgcattagccaaacacat
gatgtcatggaaatgatctttaaggaacttcagggaataagtcagattgaaacagaactt
tctgaactacgagggcatgtcaatgctctcaagcactccatcgatgagatctccagcagt
gtggaggttgtacaaagtgaaattgagcagctacgtacagggtttgtccagtctcggagg
gaaactagagacatccatgattatattaagcacttaggtcatatgggtagcaaggcaagc
ctgagatttttaaacgtgcctgaagaaagatttgaatatgttgaaagtgtggtataccaa
attctaatagataaaatgggtttttcagatgcaccaaatgctattaaaattgaatttgct
cagaggataggacaccagagggactgcccaaatgcaaagcctcgacccatacttgtgtac
tttgaaacccctcagcaaagggattctgtcttaaaaaaatcatataaactcaaaggaaca
ggcattggtatctcaacagatattctaactcatgacatcagagaaagaaaagagaaaggg
ataccatcctcccagacatatgagagcatggatataaagttgtctactccagagccaaaa
atcaagaagaacaattggcagtcacctgatgacagtgatgaagatcttgaatctgacctc
aatagaaatagttacgctgtgcttcccaagtcagagcttctaacaaagggaagtatttcc
aagccaagctcaaaatcacacagtgctagatccaagaataaaactgctaatagcagcaga
atttcaaataaatcagattatgataaaatctcctcgcagttgccagaatcagatatcttg
gaaaagcaaaccacaacccattatgcagatgcaacacctctctggcactcacagagtgat
tttttcactgctaaacttagtcgttctgaatcagatttttccaaattgtgtcagtcttac
tcagaggatttttcagaaaatcagtttttcactagaactaatggaagctctctcctgtca
tcttcggaccgggagctatggcagaggaaacaggaaggaacagcgaccctgtatgagagt
cccaaggaccagcatttgaatggaagtgttcagggtatccaagggcagactgaaattgaa
aacacagaaactgtggatagtggaatgagtaatggcatggtgtgtgcatctggagaccag
agtcattacggtgattctcagctctctttacatgaggatctttctccatggaaggaatgg
aatcaaggagagcaaggagctgatttaggcttggattcatccacccaggaaggttttgat
tatgaaacaaacagtctttctgaccaacagcttggtgtttacagtaaagacctagaatac
ttgggaaagtgccacagtgatcttcaagatgactcagagagctatgacttaactcaagat
gacaattcttctccatgccctggcttggataatgaaccacaaggccagtgggttggccag
tatgattcttatcagggagctaattctaatgagctataccaaaatcaaaaccagttgtcc
atgatgtatcaaagtcaaagtgaattgcaaagtgatgactctgaggatgccccacccaaa
tcatggcatagtcgattaagcattgacctttctgataagactttcagcttcccaaaattt
ggatctacactgcagagggctaaatcagccttggaagtagtatggaacaaaagcacacag
agtctgagtgggtatgaggacagtggctcttcattaatggggagatttcggacattatct
caatcaactgcaaatgagtcaagtaccacacttgactctgaggtctacacggagccctat
tactataaagcagagaatgaggaagattatactgaaccagtggctgataatgaaacagat
tatgttgaagtgatggaacaagtccttgctaaactagaaaacaggagtagtattactgaa
acagatgaacaaatgcaagcatatgatcaccttttgtatgaaacaccttatgaaacccca
caagatgagggttatgatggtccagcagatgatatggttagtgaagagggattagaaccc
ttaaatgaaacatcagctgagatggaaataagagaagatgaaaaccaaaacattcctgaa
cagccagtggagatcacaaagccaaagagaattcgtccttctttcaaagaagcagcttta
agggcctataaaaagcaaatggcggagttggaagagaagatcatggctggagatagcagt
tctgtggatgaaaaggctcgaataagtggcaatgatttggatgcttccaaattttctgca
ctccaggtgtgtggtggggctggaggtggactttatggtattgacagcatgccggatctt
cgcagaaagaaaactttgcctattgtccgagatgtggccatgaccctggctgcccggaaa
tctggactctccctggctatggtgattaggacatccctaaataatgaggaactgaaaatg
cacgtcttcaagaagaccttgcaggcactgatctaccctatgtcttctaccaccccacac
aattttgaggtctggacggctaccacgcccacctactgttatgagtgtgaagggctcctg
tggggcattgcaaggcaaggcatgaagtgtctggagtgtggagtgaaatgccacgaaaag
tgtcaggacctgctaaatgctgactgcttgcagagagcagcagaaaagagttctaaacat
ggtgccgaagacaagactcagaccattattacagcaatgaaagaaagaatgaagatcagg
gagaaaaaccggccagaagtatttgaagtaatccaggaaatgtttcagatttctaaagaa
gattttgtgcagtttacaaaggcggccaaacagagtgtactggatgggacatctaagtgg
tctgcaaaaataaccattacagtggtttctgcacagggtctacaggcaaaagataaaaca
gggtctagtgatccatatgttacagttcaagttggaaagaacaaaagaagaacaaaaacc
atttttggaaatttgaatccagtatgggatgagaagttttattttgagtgtcataactcc
acagatcgaatcaaagtcagagtatgggatgaagatgatgatattaaatccagagtcaag
caacatttcaaaaaggagtcagatgattttctgggacaaacaattgtagaagtgaggacc
ttgagtggagaaatggatgtctggtacaacttagagaaaaggacagataagtcagctgta
tctggggccatacgattgaaaatcaatgtggagataaaaggagaagagaaggttgctcca
tatcatattcaatatacatgtttacatgagaatctgttccattacttgactgaagtgaaa
tctaatggtggagtgaaaatcccagaagtcaaaggggatgaagcctggaaggttttcttt
gatgatgcttcccaagaaatagttgatgagtttgctatgcgttatggaattgaatccatt
tatcaagctatgacgcacttttcatgtctgtcttctaaatacatgtgccccggtgtccct
gccgtcatgagcaccttgctggctaatataaatgctttttatgctcacacaacagtttca
acaaatgtacaggtttctgcctcagatcgatttgctgctaccaactttggtagggaaaaa
ttcataaaactactggaccagttacataactctttgaggattgatctgtcaaagtatagg
gaaaactttcctgcaagcaatactgaaagactgcaagacctgaaatcaactgttgacctg
ttaacaagtatcaccttttttaggatgaaggttctggagctgcaaagccccccaaaagcg
agcatggtggtgaaggactgtgtaagagcttgcctggattctacatacaagtatattttt
gacaattgccatgaactctattcccaactaacggacccgagtaagaaacaggatattcct
cgtgaagatcagggaccaaccaccaagaatttggatttttggccccaacttattacactg
atggttactattattgatgaggataaaactgcctacacacctatcctgaatcagtttcct
caagagctgaacatgggaaaaataagtgccgaaattatgtggactctttttgctctggat
atgaaatatgcattagaagaacatgaaaatcagcggttatgcaagagcaccgattatatg
aatttgcatttcaaagttaaatggttttataatgaatatgtgcgtgaacttcctgccttc
aaggatgctgttcctgaatactccttgtggtttgaaccttttgtcatgcagtggctagat
gaaaacgaagatgtgtcaatggaattccttcatggagcactgggaagagacaaaaaagat
ggattccagcagacatctgatcatgccctcttttcttgctccgtggttgatgtctttgct
cagctgaatcagagctttgagattattaagaaactggaatgccctaatcctgaagcatta
tctcacttaatgagaagatttgcaaagactatcaataaagtgctgctccagtatgctgca
attgtatcaagtgatttcagttcatattgtgataaggaaaatgtgccctgtatcttgatg
aacaatattcaacaattgcgggtccagctggaaaaaatgtttgaatccatgggagggaaa
gagctagattctgaagctagtactattctaaaagaacttcaggttaagctcagtggggtc
ctggatgagctcagcgtcacttatggtgaaagtttccaggttataattgaagagtgtata
aaacagatgagtttcgaactaaatcaaatgagagcaaatggaaacaccacatctaataag
aacagtgcagcaatggatgcagagattgtgttaagatctcttatggattttttggacaaa
acattaagtatctcagcaaaaatctgtgagaaaacagtcctaaagcgagttttaaaagag
ttatggaagctagttctcaacaaaatagaaaaacaaattgttcttcctcctctgacagat
caaacaggaccccagatgattttcattgcagctaaagatcttggacagttatccaaactg
aaggagcacatgattcgagaggatgccaagggtctgacgccaagacaatgcgctataatg
gaggtagtcctggccaccatcaagcaatactttcatgcaggaggaaatggcctgaaaaag
aatttcttggagaaaagcccagatcttcagtctctgagatatgctctcagtctttatacc
caaactactgatgccttgataaagaaattcatagatactcaaacctcacagagtcgttcc
tccaaagatgctgtgggtcagatatctgttcatgtggacatcactgccaccccaggaacg
ggtgatcataaagtcactgtaaaagtgattgctattaatgacctaaactggcagaccaca
gcaatgttccgcccctttgtggaagtttgtatactgggacccaaccttggagacaagaag
agaaaacaaggcacaaaaacaaaaagcaacacatggtcaccaaagtacaatgaaacattt
cagttcattctgggaaaggaaaatcgaccaggagcttatgaacttcatctctcagttaag
gattactgctttgccagagaagatcgaattatcggaatgacagtcattcagctacagaac
atagcagaaaagggaagctatggggcatggtatcctcttctgaaaaatatctctatggat
gaaactggtttgactatccttagaatactctctcagaggaccagtgatgatgtggctaaa
gaatttgtaagacttaaatctgaaacaagatctactgaagagaatgcttga

DBGET integrated database retrieval system