KEGG   Pongo abelii (Sumatran orangutan): 100451685Help
Entry
100451685         CDS       T01416                                 

Gene name
CACNA2D2
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-2 isoform X1
  KO
K04859  voltage-dependent calcium channel alpha-2/delta-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04260  Cardiac muscle contraction
pon04261  Adrenergic signaling in cardiomyocytes
pon04921  Oxytocin signaling pathway
pon05410  Hypertrophic cardiomyopathy (HCM)
pon05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
pon05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100451685 (CACNA2D2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100451685 (CACNA2D2)
  Circulatory system
   04260 Cardiac muscle contraction
    100451685 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    100451685 (CACNA2D2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100451685 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100451685 (CACNA2D2)
   05414 Dilated cardiomyopathy (DCM)
    100451685 (CACNA2D2)
Ion channels [BR:pon04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100451685 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 dCache_2 VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 100451685
NCBI-ProteinID: XP_024100568
Ensembl: ENSPPYG00000013839
Position
3
AA seq 1153 aa AA seqDB search
MAVPARTCGASRPGPARTARPWPGCGPQPGPGTRRPTSGPPRPLWLLLPPLLLLPLLAAP
GASAYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVE
KVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESED
VERGSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFME
NRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVD
VSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFK
EAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWP
NRTVRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAG
KEAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRL
TPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMI
DGNKGHKQIRTLVKSLDERYIDEVTRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQI
LQVKLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTP
DSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAED
WTENPEPFNASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGRRTL
RPAVVGVKLDLEAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGG
FLVLSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPR
GVFVPTVADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMKQ
TQYYFGSVNSSYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHS
DGPEQCELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPR
PQPQVLVHASRRL
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgccggctcggacctgcggcgcctctcggcccggccccgcgcggactgcgcgc
ccctggcccggctgcggcccccagcctggccccggcacccggcgcccgacgtccgggccc
ccgcgcccgctgtggctgctgctgccgccgctgctgcttctaccgctgctcgccgccccc
ggcgcctctgcctacagcttcccccagcagcacacgatgcagcactgggcccggcgtctg
gagcaggaggtcgatggcgtgatgcggatttttggaggcgtccagcagctccgtgagatt
tacaaggacaaccggaacctgttcgaggtacaggagaatgagcctcagaagttggtggag
aaggtggcgggggacattgagagcctgctggacaggaaggtgcaggccctgaagagactg
gctgatgctgcagagaacttccagaaagcacaccgctggcaggacaacatcaaggaggaa
gacatcgtgtactatgacgccaaggctgacgctgagctggacgaccctgagagtgaggat
gtggaaagggggtctaaggccagcaccctaaggctggacttcatcgaggacccaaacttc
aagaacaaggtcaactattcatacgcggctgtacagatccccacggacatctacaaaggc
tccaccgtcatcctcaatgagctcaactggacagaggccctggagaatgtgttcatggaa
aaccgcaggcaagaccccacgctgctgtggcaggtcttcggcagcgccacaggagtcact
cgctactacccggccaccccatggcgagcccccaagaagatcgacctgtacgatgtccga
aggagaccctggtacatccagggggcctcatcacccaaagacatggtcatcatcgtggat
gtgagtggcagtgtgagtggcctgaccctgaaactgatgaagacatctgtctgtgagatg
ctggacacgctgtctgatgatgactatgtgaatgtggcctcgttcaacgagaaggcacag
cctgtgtcatgcttcacacacctggtgcaggccaatgtgcgcaacaagaaggtgttcaag
gaagctgtgcagggcatggtggccaagggcaccacaggctacaaggccggctttgagtat
gcctttgaccagctgcagaactccaacatcactcgggccaactgcaacaagatgatcatg
atgttcacggatggtggcgaggaccgcgtgcaggatgtctttgagaagtacaattggcca
aatcggacggtgcgtgtgtttactttctccgtggggcagcataattatgacgtcacaccg
ctgcagtggatggcctgcgccaacaaaggctactattttgagatcccttctatcggagcc
atccgcatcaacacacaggaatatctagatgtgttgggcaggcccatggtgctggcaggc
aaggaggccaagcaggtgcagtggaccaacgtgtatgaggatgcactgggactggggttg
gtggtaacagggaccctccctgttttcaacctgacacaggatggccctggggaaaagaag
aaccagctgatcctgggcgtgatgggcattgacgtggctctgaatgacatcaagaggctg
acccccaactacacgcttggagccaacggctatgtgtttgccattgacctgaacggctac
gtgttgctgcaccccaatctcaagccccagaccaccaacttccgggagcctgtgactctg
gacttcctggatgcggagctagaggatgagaacaaggaagagatccgtcggagcatgatt
gatggcaacaagggccacaagcagatcagaacgttggtcaagtccctggatgagaggtac
atagatgaggtgacacggaactacacctgggtgcctataaggagcactaactacagcctg
gggctggtgctcccaccctacagcaccttctacctccaagccaatctcagtgaccagatc
ctgcaggtcaagttgccaatcagcaaactgaaggattttgaattcctgctccccagcagc
tttgagtctgaaggacatgttttcattgctcccagagagtactgcaaggacctgaatgcc
tcagacaacaacaccgagttcctgaaaaactttattgagctcatggagaaagtgactcca
gactccaagcagtgcaacaacttccttctgcacaacctgatcttggacacgggcatcacg
cagcagctggtagagcgtgtgtggagggaccaggatctcaacacgtacagcctactggcc
gtgttcgctgccacagacggcggcatcacccgagtcttccccaacaaggcagctgaggac
tggacagagaaccctgagcccttcaatgccagtttctaccgccgcagcctggataaccac
ggttatgtcttcaagcccccacaccaggatgccctgttaaggccgctggagctggagaat
gacaccgtgggcatcctcgtcagtacagctgtggagctcagcctaggcaggcgcacactg
aggccagcagtggtgggcgtcaagctggacctagaggcttgggctgagaagttcaaggtg
ctagccagcaaccgtacccaccaagaccagcctcagaagtgcggccccaacagccactgt
gagatggactgcgaggttaacaatgaggacttactctgtgtcctcattgatgatggagga
ttcctggtgctgtcaaaccagaaccatcagtgggaccaggtgggcaggttcttcagtgag
gtggatgccaacctgatgctggcactctacaataactccttctacacccgcaaggagtcc
tatgactatcaggcagcctgtgcccctcagccccctggcaacctgggtgctgcaccccgg
ggtgtctttgtgcccaccgttgcagatttccttaacctggcctggtggacctctgctgcc
gcctggtccctattccagcagcttctctacggcctcatctaccacagctggttccaagca
gaccccgcggaggccgaggggagccccgagacgcgcgagagcagctgcgtcatgaaacag
acccagtactacttcggctcggtaaactcctcctacaacgccatcatcgactgcggaaac
tgttccaggctgttccacgcgcagagactgaccaacaccaaccttctcttcgtggtggcc
gagaagccgctgtgcagccagtgcgaggctggccggctgctgcagaaggaaacgcactcg
gacggcccggagcagtgtgagctagtgcagagaccgcgataccggagaggcccgcacatc
tgcttcgactacaacgcgacagaagatacctcagactgtggccgcggggcctccttcccg
ccgtcgctgggcgtcctggtctccctgcaactgctgctccttctgggcctgccgccccgg
ccgcagcctcaagtcctcgtccacgcctctcgccgcctctga

DBGET integrated database retrieval system