KEGG   Pongo abelii (Sumatran orangutan): 100451932Help
Entry
100451932         CDS       T01416                                 

Gene name
ADH1C
Definition
alcohol dehydrogenase 1C (class I), gamma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100451932 (ADH1C)
  Lipid metabolism
   00071 Fatty acid degradation
    100451932 (ADH1C)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100451932 (ADH1C)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100451932 (ADH1C)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100451932 (ADH1C)
   00982 Drug metabolism - cytochrome P450
    100451932 (ADH1C)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100451932 (ADH1C)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100451932 (ADH1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTVVT
PLPAILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDVSNP
RGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGQLDTMMASLLCCHEACGTSVIVGLPPDSQ
NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNVLPFEKINEGF
DLLRSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtagaggttgcacctcctaaggctcatgaagttcgcattaag
atggtggctgcaggaatctgtcgttcagatgaccatgtggttagtggtaccgtggtgacc
ccccttcctgcgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagaatttgtaaaaacccagaaagcaactactgcttgaaaaatgatgtgagcaatcct
cgggggaccctgcaggacggcaccaggaggttcacctgcagggggaagcccattcaccac
ttccttggcaccagcaccttctcccagtacacggtggtggatgagaatgcagtagccaaa
attgatgcagcctcgcccctggagaaggtctgcctcattggctgtggattttcgactggt
tatgggtctgcagtcaaagttgccaaggtcaccccagggtctacctgtgctgtctttggc
ctgggaggggtcggcctatctgttgttatgggctgtaaagcagctggagcggccaggatc
attgcggtggacatcaacaaggacaaatttgcaaaggctaaagaattgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccattcaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcagctcgacaccatgatggcttcccta
ttatgttgtcatgaggcatgtggcacaagtgtcattgtagggttacctcctgattcccag
aacctctcaataaaccctatgctgctactgactggacgcacgtggaaaggagctattttt
ggaggctttaagagtaaagaatctgtccccaaacttgtggctgactttatggctaagaag
ttttcactggatgcattaataacaaatgttttaccttttgaaaaaataaatgaaggattt
gacttgcttcgctctggaaagagtatccgtacagtcctgacgttttga

DBGET integrated database retrieval system