KEGG   Pongo abelii (Sumatran orangutan): 100451932Help
Entry
100451932         CDS       T01416                                 

Gene name
ADH1C
Definition
alcohol dehydrogenase 1C (class I), gamma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pon00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pon00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pon00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:pon00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:pon00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:pon00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:pon05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTVVT
PLPAILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDVSNP
RGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGQLDTMMASLLCCHEACGTSVIVGLPPDSQ
NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNVLPFEKINEGF
DLLRSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtagaggttgcacctcctaaggctcatgaagttcgcattaag
atggtggctgcaggaatctgtcgttcagatgaccatgtggttagtggtaccgtggtgacc
ccccttcctgcgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagaatttgtaaaaacccagaaagcaactactgcttgaaaaatgatgtgagcaatcct
cgggggaccctgcaggacggcaccaggaggttcacctgcagggggaagcccattcaccac
ttccttggcaccagcaccttctcccagtacacggtggtggatgagaatgcagtagccaaa
attgatgcagcctcgcccctggagaaggtctgcctcattggctgtggattttcgactggt
tatgggtctgcagtcaaagttgccaaggtcaccccagggtctacctgtgctgtctttggc
ctgggaggggtcggcctatctgttgttatgggctgtaaagcagctggagcggccaggatc
attgcggtggacatcaacaaggacaaatttgcaaaggctaaagaattgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccattcaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcagctcgacaccatgatggcttcccta
ttatgttgtcatgaggcatgtggcacaagtgtcattgtagggttacctcctgattcccag
aacctctcaataaaccctatgctgctactgactggacgcacgtggaaaggagctattttt
ggaggctttaagagtaaagaatctgtccccaaacttgtggctgactttatggctaagaag
ttttcactggatgcattaataacaaatgttttaccttttgaaaaaataaatgaaggattt
gacttgcttcgctctggaaagagtatccgtacagtcctgacgttttga

DBGET integrated database retrieval system