KEGG   Pongo abelii (Sumatran orangutan): 100451932Help
Entry
100451932         CDS       T01416                                 

Definition
(RefSeq) alcohol dehydrogenase 1C
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00071  Fatty acid degradation
pon00350  Tyrosine metabolism
pon00830  Retinol metabolism
pon00980  Metabolism of xenobiotics by cytochrome P450
pon00982  Drug metabolism - cytochrome P450
pon01100  Metabolic pathways
pon05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100451932
  Lipid metabolism
   00071 Fatty acid degradation
    100451932
  Amino acid metabolism
   00350 Tyrosine metabolism
    100451932
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100451932
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100451932
   00982 Drug metabolism - cytochrome P450
    100451932
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100451932
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100451932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 100451932
NCBI-ProteinID: XP_002815037
Position
4
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTVVT
PLPAILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDVSNP
RGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGQLDTMMASLLCCHEACGTSVIVGLPPDSQ
NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNVLPFEKINEGF
DLLRSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtagaggttgcacctcctaaggctcatgaagttcgcattaag
atggtggctgcaggaatctgtcgttcagatgaccatgtggttagtggtaccgtggtgacc
ccccttcctgcgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagaatttgtaaaaacccagaaagcaactactgcttgaaaaatgatgtgagcaatcct
cgggggaccctgcaggacggcaccaggaggttcacctgcagggggaagcccattcaccac
ttccttggcaccagcaccttctcccagtacacggtggtggatgagaatgcagtagccaaa
attgatgcagcctcgcccctggagaaggtctgcctcattggctgtggattttcgactggt
tatgggtctgcagtcaaagttgccaaggtcaccccagggtctacctgtgctgtctttggc
ctgggaggggtcggcctatctgttgttatgggctgtaaagcagctggagcggccaggatc
attgcggtggacatcaacaaggacaaatttgcaaaggctaaagaattgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccattcaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcagctcgacaccatgatggcttcccta
ttatgttgtcatgaggcatgtggcacaagtgtcattgtagggttacctcctgattcccag
aacctctcaataaaccctatgctgctactgactggacgcacgtggaaaggagctattttt
ggaggctttaagagtaaagaatctgtccccaaacttgtggctgactttatggctaagaag
ttttcactggatgcattaataacaaatgttttaccttttgaaaaaataaatgaaggattt
gacttgcttcgctctggaaagagtatccgtacagtcctgacgttttga

DBGET integrated database retrieval system