KEGG   Pongo abelii (Sumatran orangutan): 100452085Help
Entry
100452085         CDS       T01416                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100452085 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 418 aa AA seqDB search
MGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDH
VAVYPANDSALVNQLGKILGADLDVIMXLNNLDEESNKKHPFPCPTSYRTALTYYLDITN
PPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRP
PIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINKGVATNWLRAKEP
AGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGE
TLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKRDREHLWKL
IEGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggggagatgggccggctgaagagctacgagaaccagaagcccccctttgatgccaag
aatccgttcctggctgcagtcaccaccaaccggaagctgaaccagggaaccgagcgccac
ctcatgcacctggaattggacatctcggactccaaaatcaggtatgaatctggggaccac
gtggctgtatacccagccaacgactctgctctcgtcaaccagctgggcaaaatcctgggt
gccgacctggacgtcatcatgntcctgaacaacctggatgaggagtccaacaagaagcac
ccattcccgtgccccacgtcctaccgcacggccctcacctactacctggacatcaccaac
ccgccgcgcaccaacgtgctgtacgagctggcgcagtacgcctcggagccctcggagcag
gagctgctgcgcaagatggcctcctcctccggcgagggcaaggagctgtacctgagctgg
gtggtggaggcccggaggcacatcctggccattctgcaggactgcccgtccctgcggccc
cccatcgaccacctgtgtgagctgctgccgcgcctgcaggcccgctactactccatcgcc
tcatcctccaaagtccaccccaactccgtgcacatatgtgcagtggttgtggagtacgag
accaaggccggccgcatcaacaagggtgtggccaccaactggctgcgggccaaggagcct
gctggggagaacggcggccgtgcgctggtgcccatgttcgtgcgcaagtcccagttccgc
ctgcccttcaaggccactacgcctgtcatcatggtgggccccggcaccggggtggcaccc
ttcataggcttcatccaggagcgggcctggctgagacagcagggcaaggaggtgggggag
acgctgctgtactacggctgccgccgctcagatgaggactacctgtaccgggaggagctg
gcgcagttccacagggacggtgcgctcacccagctcaacgtggccttctcccgggagcag
tcccacaaggtctacgtccagcacctgttaaagcgagaccgagagcacctgtggaagttg
atcgaaggcggcgcccacatctacgtctgtggggatgcacggaacatggccagggatgtg
cagaacaccttctacgacatcgtggctgagctcggggccatggagcacgcgcaggcagtg
gactacatcaagaaactgatgaccaagggccgctactccctggacgtgtggagctag

DBGET integrated database retrieval system