KEGG   Pongo abelii (Sumatran orangutan): 100452085Help
Entry
100452085         CDS       T01416                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 591 aa AA seqDB search
MGCMYSSPPEEPALRRTSSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHR
YGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQXTDVDLS
GVSSRLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGEMGRL
KSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPAN
DSALVNQLGKILGADLDVIMXLNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVL
YELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCE
LLPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINKGVATNWLRAKEPAGENGGR
ALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGETLLYYGC
RRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKRDREHLWKLIEGGAHI
YVCGDARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcatgtactcgtctccacctgaggagcccgctctgagaaggacctcctctgtc
agagagagcagctttgtggaaaagatgaagaaaacggggaggaacatcattgtgttctac
ggctcccagacggggactgcagaggagtttgccaaccgcctgtccaaggatgcccaccgc
tacgggatgcgaggcatgtcagcggaccctgaggagtatgacttggccgacctgagcagc
ctgccagagatcgacaacgccctggtggttttctgcatggccacctacggcgagggggac
cccaccgacaatgcccaggacttctacgactggctgcagnngacggacgtggatctctct
ggggtcagttcgcgcttggaggaggacttcatcacctggcgagagcagttctggccggcc
gtgtgcgagcactttggggtggaagccactggcgaggagtccagcattcgccagtacgag
ctcgtggtccacacggacatagacgcggccaaggtgtacatgggggagatgggccggctg
aagagctacgagaaccagaagcccccctttgatgccaagaatccgttcctggctgcagtc
accaccaaccggaagctgaaccagggaaccgagcgccacctcatgcacctggaattggac
atctcggactccaaaatcaggtatgaatctggggaccacgtggctgtatacccagccaac
gactctgctctcgtcaaccagctgggcaaaatcctgggtgccgacctggacgtcatcatg
ntcctgaacaacctggatgaggagtccaacaagaagcacccattcccgtgccccacgtcc
taccgcacggccctcacctactacctggacatcaccaacccgccgcgcaccaacgtgctg
tacgagctggcgcagtacgcctcggagccctcggagcaggagctgctgcgcaagatggcc
tcctcctccggcgagggcaaggagctgtacctgagctgggtggtggaggcccggaggcac
atcctggccattctgcaggactgcccgtccctgcggccccccatcgaccacctgtgtgag
ctgctgccgcgcctgcaggcccgctactactccatcgcctcatcctccaaagtccacccc
aactccgtgcacatatgtgcagtggttgtggagtacgagaccaaggccggccgcatcaac
aagggtgtggccaccaactggctgcgggccaaggagcctgctggggagaacggcggccgt
gcgctggtgcccatgttcgtgcgcaagtcccagttccgcctgcccttcaaggccactacg
cctgtcatcatggtgggccccggcaccggggtggcacccttcataggcttcatccaggag
cgggcctggctgagacagcagggcaaggaggtgggggagacgctgctgtactacggctgc
cgccgctcagatgaggactacctgtaccgggaggagctggcgcagttccacagggacggt
gcgctcacccagctcaacgtggccttctcccgggagcagtcccacaaggtctacgtccag
cacctgttaaagcgagaccgagagcacctgtggaagttgatcgaaggcggcgcccacatc
tacgtctgtggggatgcacggaacatggccagggatgtgcagaacaccttctacgacatc
gtggctgagctcggggccatggagcacgcgcaggcagtggactacatcaagaaactgatg
accaagggccgctactccctggacgtgtggagctag

DBGET integrated database retrieval system