KEGG   Pongo abelii (Sumatran orangutan): 100452168Help
Entry
100452168         CDS       T01416                                 

Gene name
USP36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100452168 (USP36)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100452168 (USP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 1124 aa AA seqDB search
MPIVDKLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLESLKSKY
VLLNPKTEGASRHKSGDDPPPARRQGSEHMYESCGDGVPAPQKVLFPTERLSLRWERVFR
VGAGLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFA
NSGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATT
LVHQIFGGYLRSRVKCSMCKSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENA
YMCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQNN
GDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLF
YLRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKL
HTTEEIGVPISRNGSTLGLKSQNGCVPPKLPSGSPSPKLSQAPTHMPTILDDPGKKVKKP
APPQHFSPRTAQGLPGTSSSNSSRSGSQRQGSWDSRDVVLSTSPKLLATATANGHGLKGN
DESTGLDRRSSSSSSPEHSASSNSTKVPQTPRSGAAHLCDSQETNCSTAGHSKTPPSGAD
SKTVKLKSPVLSNATAEPASTMSPPPAKKLALSAKKASTLWRATGNDLRPPPPSPSSDLT
HPMKTSHPIVASTWPVHRARAVSPAPQSSSRLQPPFSPHPTLLSSTPKPPGTSEPRSCSS
ISTALPQVNEDLVSLPHQLPEASEPPRSPSEKRKKTFVGELQRLGSETCLSQHIREATAA
PHGKRKRKKKKRLEDTAATALQEGQTQRQPGSPRHRREGQAQLPAVRRQEDGTQPQVNGQ
QVGCVTDGHHASSRKRRRKGAEGLGEEGGLHQDPPWHSCSPMGDGDPEAVEESPRKKKKR
KRKQEPQRAVEEDGHLECPRSAKPRDAAVPESSSRAPSANGWCPGDRMGLSQAPPVSWNG
ERESDVVQELLKYSSDKAYGRKVLTWDGKMSAVSQDAVEDSRQARTETVVDDWDEEFDRG
KEKKIKKFKREKRRNFNAFQKLQTRRNFWSVTHPAKAASLSYRR
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgccaatagtggataagttgaaggaggccctgaaacccggccgcaaggactcggctgat
gatggagaactggggaagcttcttgcctcctctgccaagaaggtccttttacagaagatt
gagttcgagccagccagcaagagcttctcctaccagctggagtccttaaagagcaaatat
gtgttgctcaaccccaaaacagagggagctagtcgccacaagagtggagatgacccacca
ccggccaggagacagggcagtgagcacatgtatgagagctgtggtgacggagtcccagcc
ccgcagaaagtgcttttccccacggagcgactgtctctgaggtgggagcgggtgttccgc
gtgggcgcgggactccacaaccttggcaacacctgctttctcaatgccaccattcagtgc
ttgacctacacaccacctctagccaactacctgctctccaaggagcatgctcgcagctgc
caccagggaagcttctgcatgctgtgtgtcatgcagaaccacatcgtccaggccttcgcc
aacagcggcaacgccatcaagcccgtctccttcatccgagacctgaaaaagatcgcccgg
cacttccgctttgggaaccaggaggacgcgcatgagttcctgcggtacaccattgacgcc
atgcagaaggcctgcctgaatggctgcgccaagttggatcgtcaaacgcaggctactacc
ttggtccatcagatttttggagggtatctcagatcacgtgtgaagtgctccatgtgcaag
agcgtctcggacacctacgacccctacttggacgttgcgctggagatccggcaagctgcg
aatattgtgcgtgctctggaactttttgtgaaagcagatgtcctgagtggagagaatgcc
tacatgtgtgctaaatgcaagaagaaggttccagccagcaagcgcttcaccatccacaga
acatccaatgtcttaaccctttccctcaagcgctttgccaacttcagcggagggaagatc
accaaggatgtaggctatccggaattcctcaacatacgtccgtatatgtcccagaataat
ggtgatcctgtcatgtatggactctatgctgtcctggtgcactcgggctacagctgccat
gccgggcactattactgctacgtgaaggcaagcaatggacagtggtaccagatgaatgat
tccttggtccattccagcaacgtcaaggtggttctgaaccagcaggcctacgtgctgttc
tatctgcgaattccaggctctaagaaaagtcccgagggcctcatctccaggacaggctcc
tcctcccttcccggccgcccgagtgtgattccagatcattccaagaagaacatcggcaac
gggattatttcctccccactgactggaaagcgacaagactctgggacgatgaagaagctg
cacaccactgaagagattggtgtgcccatatccaggaatggctccaccctgggcctgaag
tcccagaacggctgtgttcctccaaagctgccctcggggtccccttcccccaaactctcc
caggcacccacacacatgccaaccatcctagatgaccctggaaagaaggtgaagaaacca
gctcctccacagcacttttcccccagaactgctcaggggctgcctgggaccagcagctcg
aatagcagcagatctgggagccaaaggcagggctcctgggacagcagggatgttgtcctc
tctacctcacctaagctcctggctacagccactgccaacgggcatgggctgaaggggaac
gacgagagcactggcctcgacaggaggagctccagcagctccagcccagagcactcggcc
agcagcaactccaccaaggtcccccagacccccaggagtggcgcggcccatctctgcgat
tctcaggaaacaaactgttccaccgctggccactccaaaacgccgccaagtggagcagat
tctaagacggtgaagctgaagtcccctgtcctgagcaacgccaccgctgagcctgcaagc
accatgtctcctccaccagccaaaaaactggccctttctgccaagaaggccagcaccctg
tggagggcgaccggcaatgacctccgtccacctcccccctcaccatcctccgacctcacc
caccccatgaaaacctctcaccccatcgttgcctccacttggcccgtccatagagccagg
gctgtttcacctgctccccagtcatccagccgcctgcagccccccttcagcccccacccc
acattgctgtccagtacccccaagcccccagggacgtcagaaccacggagctgctcctcc
atctcgacggccctgcctcaggtcaacgaggaccttgtgtcccttccacaccagctgcca
gaggccagtgagcccccccggagcccctctgagaagaggaaaaagaccttcgtgggagag
ctccagaggctgggctcagagacgtgcctctcacagcacatcagggaggccactgcggct
ccccacgggaagaggaagaggaagaagaagaagcgcctggaggacacagctgccactgcc
ctgcaggaggggcagacacagagacagcctgggagccccaggcacaggagggagggccag
gcacagctgcccgctgtcagacggcaggaagatggcacacagccacaggtgaatggccag
caggtgggatgtgttacggacggccaccacgcgagcagcaggaagcggaggaggaaagga
gcagaaggtcttggtgaagaaggcggcctgcaccaggacccaccttggcacagctgctct
cccatgggtgatggtgatccagaggccgtggaagagtctccaaggaaaaagaaaaagaga
aaaagaaagcaggagccacagcgggcggtagaagaggatgggcatctcgaatgcccaagg
agtgccaagccccgagatgctgctgtccctgagtccagcagccgcgcaccatctgcgaat
ggctggtgtcctggggaccgcatggggctgagccaggcccctcctgtgtcttggaatgga
gagcgagagtctgatgtggtccaggaactgctcaaatactcatctgataaagcttacggg
agaaaagttctgacctgggatggcaagatgtcagcggtcagtcaggatgctgttgaagat
agcagacaggctcggactgagaccgtggttgatgactgggacgaagagtttgaccgaggg
aaggaaaagaaaattaaaaaatttaagagagagaagaggagaaacttcaacgccttccag
aaacttcagactcgacggaacttctggtctgtgactcacccagcaaaggctgccagcctc
agctatcgccgctga

DBGET integrated database retrieval system