KEGG   Pongo abelii (Sumatran orangutan): 100452326Help
Entry
100452326         CDS       T01416                                 

Gene name
POM121L2
Definition
(RefSeq) POM121-like protein 2
  KO
K14316  nuclear pore complex protein Nup121
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03013  RNA transport
Module
pon_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100452326 (POM121L2)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100452326 (POM121L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POM121
Motif
Other DBs
NCBI-GeneID: 100452326
NCBI-ProteinID: XP_024103847
Position
6
AA seq 1035 aa AA seqDB search
MGSFLSKLGLSPSSPAHVRTDLPERPTKRRPTQPLHQVHRVQFVHRAHPAPRYRPVRRRP
NLDPANPTTWLANEAWRRFPMKKSQNSPLGPLPSDWWESYLKRTIWSLRHPRPIWSPVTI
KITPPDQRVPPSTSPEDVIALAGLPPSEELSDPCSKETVFRALRECKKGKGRLEEPLFPE
SLDSKRRSPETRPSAFKPLMKSGTLTSFVPRPGPLKRSLHSWGSDHSLTKRPSCSSMSSL
ASIYRGGTLSSKRNAISSSYSSSRNFSDPWKRSVPSVSFETPEWPIKKEKSCHRPYSPVP
LVSDFESLGASESSGQQNQEIPQLPSSPENMVSEIPPPQLGYAVSDEDLTLGKKAELQRS
NNAREDTTEVTTDPVPETWLAIKPSLSLTLPSSGTDLTQGANPQLENLRKMQESLGPLAS
LQSTGEATSVAHSPLKTPSLLTPPGCSQSELFPGTSPDSKPTATFILLTPTSPTSPVTDT
TWQPSTSQADRFPMPPDPSAPPTIQSTLLGMVSSPTSHLSASAPPDATSAHLMLKPILGP
LNNSEIGSSSYSRISVTAAASSISSFSTTQGTLTPTFKPIFGSIDPLKTMPMIAPFSSKQ
TPPPFTHASIHHFHGLVKATSAVMSTTLASTSKDSVFKPPLDFGVVNVTSAVGNTYSVPS
TCDTFLLGTAQAFRGNFTPATGFIFPPHHHPTIPTVHTVTIFTQVLSSAVQISPRSSTAN
FRGMGSPLPASALVSTNWPASTPSISNLTPAITSPLGLSSRPPFPLSQGANPQPAFGATN
GQKQGPSQPALMPSVSSSFLFGSSALALPTLVPTPAQPAFVSTTQSALGCLTPSASTTQT
PAITWSGIGSIPAGFPISQASTTGFRIVIQTHQSGAFGSVFGSRAPQPFAFGGFVTPMDC
DESGIRMTGSDMSSTSGAFSIGALPSGTTSTMIPFGKGWSQNTEGLPSHSTAFALGRASI
SARKTMAPIAQSTPVPGQAKAGSSVGFRMPFPPAQGSVGRGSFRSSASSFSIGTKSKTSK
NWKQGHSRRHHAYKK
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtttcctgagcaaactgggactttcgccctcgtccccagcccatgtgcgcacc
gacttgcccgaaaggcccacgaaacgccggccaactcagccccttcaccaagttcatcgg
gttcagttcgtccaccgcgcccaccctgccccacggtatagacctgtgaggaggcggcca
aacctggatcctgccaatccaaccacgtggctggccaacgaggcttggaggcgctttccc
atgaagaagtcccagaattcccccctggggcctctcccttcagactggtgggaaagttac
ttaaagcggactatttggtctcttcgacatcccaggccaatttggagcccagtgaccatc
aagatcactcctcctgaccagagagtgcccccttccacttctcctgaagatgtaattgcc
cttgcaggactcccaccctctgaggagctctcagatccatgttcaaaggagacagtgttc
agggccctcagagagtgcaaaaaagggaaagggaggttggaagaaccactattccctgag
agcttggacagtaagagaaggagtccagagaccagaccatccgcatttaagcccctgatg
aaaagtggaaccctcacttcttttgtgcccaggcctgggccgctgaagagaagtctccac
tcctggggctcagatcacagcttgactaagaggcccagttgctcctccatgagctccttg
gccagcatatacagaggtggcaccctcagctccaaaaggaatgctatttccagctcttac
agctcttccagaaatttctcagacccttggaagagaagtgttcccagtgtatcatttgag
acaccagagtggccaataaaaaaggaaaaaagttgtcatcggccttactctccagtccca
ctggtatcagattttgagtccctaggagcatctgaaagttctgggcagcaaaaccaagag
attccacagctgccatctagccctgagaacatggtgtcggagatcccacctccccagctt
ggttatgcagtctctgatgaggacttgactttggggaagaaagctgagctacagcggagc
aacaacgcaagagaagatacaactgaggtcaccacagaccctgtccctgagacttggctt
gctattaagccttccctatctcttactctgccttcttcaggaacagatctaacccagggg
gcaaatcctcagttggaaaacttaagaaaaatgcaggagtctctaggtccactggcctct
ctacagtccacaggagaggcaaccagtgtggcccattctcctttgaagacacccagccta
ctgaccccacctgggtgctcacagtcagagctctttccaggcacttctccagactcaaag
cccacagctactttcatcctgctgacccccacctctcccacatcaccagttactgacacc
acctggcagccttcaacctctcaggctgacaggtttcccatgcccccagacccatctgca
ccacccaccatccaaagtactttgcttggaatggtgagtagcccaacatcccatctttct
gcatctgcacctcctgatgcaacttctgctcacctcatgttaaaaccgattttggggccg
ctgaacaacagcgagattggaagctcctcatattccagaatttcagtcacagctgcggca
tcttcaatctcttccttctccacaactcagggtaccttaactcctaccttcaagcctatc
tttggcagcatagatccacttaaaactatgcccatgatagctcctttctcctccaagcag
acccctcctccatttactcatgcttctatccatcatttccatggcctggtcaaggccacc
tctgcggtcatgtccaccaccctagccagcacatctaaagactctgtttttaagccacct
ttggattttggtgtagtgaatgttaccagtgctgtaggcaacacttattctgtcccttcc
acttgcgacactttcctgcttgggactgctcaggccttcaggggcaacttcaccccagcc
acaggattcattttcccaccacaccatcatcctacaattcctactgtgcacacagtcacc
atctttacccaggtcctttccagtgctgtacagatatcccctagaagcagcactgctaat
ttcaggggtatgggcagccctctgcctgcctctgccctagtatccacaaactggcctgca
tcaacccccagcatctccaacctgactccagcaatcacaagtccgttgggattgagctca
aggccacctttcccactatcccaaggagctaatccccagcctgcatttggtgccacaaat
ggacagaaacaagggccttcccagccagcccttatgccaagtgtcagtagctcttttctt
tttgggagctcagcactggcattgccaaccctcgtgccaactccagctcagccagccttc
gttagtaccacacagtcagccttggggtgtttgacaccctcagcctccaccactcaaacc
cctgccatcacctggtcaggcattggcagcattccagcaggttttcccattagtcaagct
agtacaactgggtttagaattgtaattcagacccaccaaagtggggcttttggctcagtg
tttggcagcagagccccacaacctttcgctttcgggggattcgtgacccctatggactgt
gatgagtctgggatcagaatgactggttcagacatgagctccacctctggagctttcagc
attggagcattgcctagtgggaccactagcaccatgatcccctttggaaaaggctggagc
cagaacactgaaggcctgcccagccatagcacagcttttgccttggggagagccagcatt
tctgcaagaaagactatggcccccattgctcaaagcaccccagtccctggacaagctaag
gcaggcagcagtgttggctttaggatgccttttccacctgcccagggctctgttgggaga
ggatcttttagatcatcagcctcttcattttccattggcacaaaatcaaaaacctcaaag
aattggaagcaagggcattcccgaaggcatcatgcctacaagaagtag

DBGET integrated database retrieval system