KEGG   Pongo abelii (Sumatran orangutan): 100452326Help
Entry
100452326         CDS       T01416                                 

Gene name
POM121L2
Definition
POM121 transmembrane nucleoporin-like 2
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100452326 (POM121L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1188 aa AA seqDB search
MSSPSANTKETWIRPLGDTGGSQRWLCGKRLTPTGGCHKCHPGGTDPPVQISSPAHLRKP
PALTPRGADSAPHSDSGDPAGRQICAGALSPLSLYLRGRVPDSRCRRQGRGAVCFLSSSS
PRAKYCNSLRREQRCDRPAEVSEQQSKLLGLPKSRFPEQLGLSPSSPAHVRTDLPERPTK
RRPTQPLHQVHRVQFVHRAHPAPRYRPVRRRPNLDPANPTTWLANEAWRRFPMKKSQNSP
LGPLPSDWWESYLKRTIWSLRHPRPIWSPVTIKITPPDQRVPPSTSPEDVIALAGLPPSE
ELSDPCSKETVFRALRECKKGKGRLEEPLFPESLDSKRRSPETRPSAFKPLMKSGTLTSF
VPRPGPLKRSLHSWGSDHSLTKRPSCSSMSSLASIYRGGTLSSKRNAISSSYSSSRNFSD
PWKRSVPSVSFETPEWPIKKEKSCHRPYSPVPLVSDFESLGASESSGQQNQEIPQLPSSP
ENMVSEIPPPQLGYAVSDEDLTLGKKAELQRSNNAREDTTEVTTDPVPETWLAIKPSLSL
TLPSSGTDLTQGANPQLENLRKMQESLGPLASLQSTGEATSVAHSPLKTPSLLTPPGCSQ
SELFPGTSPDSKPTATFILLTPTSPTSPVTDTTWQPSTSQADRFPMPPDPSAPPTIQSTL
LGMVSSPTSHLSASAPPDATSAHLMLKPILGPLNNSEIGSSSYSRISVTAAASSISSFST
TQGTLTPTFKPIFGSIDPLKTMPMIAPFSSKQTPPPFTHASIHHFHGLVKATSAVMSTTL
ASTSKDSVFKPPLDFGVVNVTSAVGNTYSVPSTCDTFLLGTAQAFRGNFTPATGFIFPPH
HHPTIPTVHTVTIFTQVLSSAVQISPRSSTANFRGMGSPLPASALVSTNWPASTPSISNL
TPAITSPLGSSSRPPFPLSQGANPQPAFGATNGQKQGPSQPALMPSVSSSFLFGSSALAL
PTLVPTPAQPAFVSTTQSALGCLTPSASTTQTPAITWSGIGSIPAGFPISQASTTGFRIC
NFRPTKVGLFGSVFGSRAPQPFAFGGFVTPMDCDESGIRMTGSDMSSTSGAFSIGALPSG
TTSTMIPFGKGWSQNTEGLPSHSTAFALGRASISARKTMAPIAQSTPVPGQAKAGSSVGF
RMPFPPAQGSVGRGSFRSSASSFSIGTKSKTSKNWKQGHSRRHHAYKK
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atgagttctccaagtgctaatacgaaggaaacctggattcggccgctgggagacacaggt
ggatctcaaaggtggctgtgcggcaaacgactgacacctactggcggctgccacaaatgc
catccgggcggcacagatccaccggtccagatctccagtcctgcgcacctgcgaaagccg
cccgcactcactccgcggggtgcggatagtgctccccactcagactccggggatcccgcg
ggccgacagatctgcgccggggccctgagccccctgagcctgtaccttcgaggccgggtc
ccagacagccgctgccgacgccaggggcgaggggcagtgtgcttcctctcgagttcctct
ccccgcgccaagtactgcaactcgctgcggagagagcagaggtgtgaccgccccgctgag
gtctcagaacagcaaagcaagttactgggactgccgaagtcccgctttcctgagcaactg
ggactttcgccctcgtccccagcccatgtgcgcaccgacttgcccgaaaggcccacgaaa
cgccggccaactcagccccttcaccaagttcatcgggttcagttcgtccaccgcgcccac
cctgccccacggtatagacctgtgaggaggcggccaaacctggatcctgccaatccaacc
acgtggctggccaacgaggcttggaggcgctttcccatgaagaagtcccagaattccccc
ctggggcctctcccttcagactggtgggaaagttacttaaagcggactatttggtctctt
cgacatcccaggccaatttggagcccagtgaccatcaagatcactcctcctgaccagaga
gtgcccccttccacttctcctgaagatgtaattgcccttgcaggactcccaccctctgag
gagctctcagatccatgttcaaaggagacagtgttcagggccctcagagagtgcaaaaaa
gggaaagggaggttggaagaaccactattccctgagagcttggacagtaagagaaggagt
ccagagaccagaccatccgcatttaagcccctgatgaaaagtggaaccctcacttctttt
gtgcccaggcctgggccgctgaagagaagtctccactcctggggctcagatcacagcttg
actaagaggcccagttgctcctccatgagctccttggccagcatatacagaggtggcacc
ctcagctccaaaaggaatgctatttccagctcttacagctcttccagaaatttctcagac
ccttggaagagaagtgttcccagtgtatcatttgagacaccagagtggccaataaaaaag
gaaaaaagttgtcatcggccttactctccagtcccactggtatcagattttgagtcccta
ggagcatctgaaagttctgggcagcaaaaccaagagattccacagctgccatctagccct
gagaacatggtgtcggagatcccacctccgcagcttggttatgcagtctctgatgaggac
ttgactttggggaagaaagctgagctacagcggagcaacaacgcaagagaagatacaact
gaggtcaccacagaccctgtccctgagacttggcttgctattaagccttccctatctctt
actctgccttcttcaggaacagatctaacccagggggcaaatcctcagttggaaaactta
agaaaaatgcaggagtctctaggtccactggcctctctacagtccacaggagaggcaacc
agtgtggcccattctcctttgaagacacccagcctactgaccccacctgggtgctcacag
tcagagctctttccaggcacttctccagactcaaagcccacagctactttcatcctgctg
acccccacctctcccacatcaccagttactgacaccacctggcagccttcaacctctcag
gctgacaggtttcccatgcccccagacccatctgcaccacccaccatccaaagtactttg
cttggaatggtgagtagcccaacatcccatctttctgcatctgcacctcctgatgcaact
tctgctcacctcatgttaaaaccgattttggggccgctgaacaacagcgagattggaagc
tcctcatattccagaatttcagtcacagctgcagcatcttcaatctcttccttctccaca
actcagggtaccttaactcctaccttcaagcctatctttggcagcatagatccacttaaa
actatgcccatgatagctcctttctcctccaagcagacccctcctccatttactcatgct
tctatccatcatttccatggcctggtcaaggccacctctgcggtcatgtccaccacccta
gccagcacatctaaagactctgtttttaagccacctttggattttggtgtagtgaatgtt
accagtgctgtaggcaacacttattctgtcccttccacttgcgacactttcctgcttggg
actgctcaggccttcaggggcaacttcaccccagccacaggattcattttcccaccacac
catcatcctacaattcctactgtgcacacagtcaccatctttacccaggtcctttccagt
gctgtacagatatcccctagaagcagcactgctaatttcaggggtatgggcagccctctg
cctgcctctgccctagtatccacaaactggcctgcatcaacccccagcatctccaacctg
actccagcaatcacaagtccgttgggatcaagctcaaggccacctttcccactatcccaa
ggagctaatccccagcctgcatttggtgccacaaatggacagaaacaagggccttcccag
ccagcccttatgccaagtgtcagtagctcttttctttttgggagctcagcactggcattg
ccaaccctcgtgccaactccagctcagccagccttcgttagtaccacacagtcagccttg
gggtgtttgacaccctcagcctccaccactcaaacccctgccatcacctggtcaggcatt
ggcagcattccagcaggttttcccattagtcaagctagtacaactgggtttagaatttgt
aatttcagacccaccaaagtggggctttttggctcagtgtttggcagcagagccccacaa
cctttcgctttcgggggattcgtgacccctatggactgtgatgagtctgggatcagaatg
actggttcagacatgagctccacctctggagctttcagcattggagcattgcctagtggg
accactagcaccatgatcccctttggaaaaggctggagccagaacactgaaggcctgccc
agccatagcacagcttttgccttggggagagccagcatttctgcaagaaagactatggcc
cccattgctcaaagcaccccagtccctggacaagctaaggcaggcagcagtgttggcttt
aggatgccttttccacctgcccagggctctgttgggagaggatcttttagatcatcagcc
tcttcattttccattggcacaaaatcaaaaacctcaaagaattggaagcaagggcattcc
cgaaggcatcatgcctacaagaagtag

DBGET integrated database retrieval system