KEGG   Pongo abelii (Sumatran orangutan): 100452461Help
Entry
100452461         CDS       T01416                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:pon00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 371 aa AA seqDB search
MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVNTQPNLLHNDPHARHSDDNWTESSR
MDKXTFNADSSQHTDENTDIAENLYQKVRILCWVMTGSKNLEKKAKHVKATWGQRCNKGV
VLXVQKKNKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDN
LRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSI
EDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGP
GCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYSYQPTLPEHILKEISQANKNEDTKV
EVRKSLKENHE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcctggctgaattttttaaccttcctctgtggatcagcaataggattt
cttttatgttctcagctatttagtattttgttgggagaaaaggtgaacacccagcctaat
cttcttcataatgatcctcatgcaaggcattcagatgataattggacagaatcatctaga
atggacaaatgaactttcaatgcagattctagccaacatacagatgagaacacagacatt
gctgaaaacctctatcagaaagttagaattctttgctgggttatgaccggctccaaaaac
ctagagaaaaaggccaaacacgtcaaagctacttggggccagcgttgtaacaaaggtgtt
gttttatgagttcagaagaaaaataaagacttccctgctgtgggattgaaaaccaaagaa
ggcagagatcaactatactggaaaacaattaaagcttttcagtatgttcatgaacattat
ttagaagatgctgattggtttttgaaagcagatgatgacacatatgtcatactagacaat
ttgaggtggcttctttcaaaatatgaccctgaagaacccatttactttgggagaagattt
aagccttatgtaaagcagggctacatgagcggaggagcaggatatgtactaagcaaagaa
gccttgaaaagatttgttgatgcatttaaaacagacaagtgtacacatagttcctccatt
gaagacttagcactggggagatgcatggaaattatgaatgtagaagcaggagattccaga
gataccattggaaaagaaacttttcatccctttgtgccagaacaccatttaattaaaggt
tatctacctagaacattttggtactggaattacaactattatcctcctgtagagggtcct
ggttgctgttctgatcttgcagtttcttttcactatgttgattctacaactatgtatgag
ttagaatacctcgtttatcatctacgtccatatggttatttatacagttatcaacctacc
ttacctgaacatatactaaaggaaattagtcaagcaaacaaaaatgaagatacaaaagtt
gaagttagaaaatccttgaaagaaaatcatgaatga

DBGET integrated database retrieval system