KEGG   Pongo abelii (Sumatran orangutan): 100452461Help
Entry
100452461         CDS       T01416                                 

Gene name
C1GALT1
Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 isoform X1
  KO
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Mucin type O-glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100452461 (C1GALT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     100452461 (C1GALT1)
Glycosyltransferases [BR:pon01003]
 Glycan extension
  Type 3 chain
   100452461 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
7
AA seq 371 aa AA seqDB search
MSEIHFREMASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKGDTQPNVLHNDPHARHSD
DNGQNHLEGQMNFNADSSQHTDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWA
QRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDT
YVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKC
THSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYY
PPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPEHILKEISQANK
NEDTKVKLENP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaatacactttcgggaaatggcctctaaatcctggctgaattttttaaccttc
ctctgtggatcagcaataggatttcttttatgttctcagctatttagtattttgttggga
gaaaagggtgacacccagcctaatgttcttcataatgatcctcatgcaaggcattcagat
gataatggacagaatcatctagaaggacaaatgaacttcaatgcagattctagccaacat
acagatgagaacacagacattgctgaaaacctctatcagaaagttagaattctttgctgg
gttatgaccggccctcaaaacctagagaaaaaggccaaacacgtcaaagctacttgggcc
cagcgttgtaacaaagtgttgtttatgagttcagaagaaaataaagacttccctgctgtg
ggattgaaaaccaaagaaggcagagatcaactatactggaaaacaattaaagcttttcag
tatgttcatgaacattatttagaagatgctgattggtttttgaaagcagatgatgacaca
tatgtcatactagacaatttgaggtggcttctttcaaaatatgaccctgaagaacccatt
tactttgggagaagatttaagccttatgtaaagcagggctacatgagcggaggagcagga
tatgtactaagcaaagaagccttgaaaagatttgttgatgcatttaaaacagacaagtgt
acacatagttcctccattgaagacttagcactgggaagatgcatggaaattatgaatgta
gaagcaggagattccagagataccattggaaaagaaacttttcatccctttgtgccagaa
caccatttaattaaaggttatctacctagaacattttggtactggaattacaactattat
cctcctgtagagggtcctggttgctgttctgatcttgcagtttcttttcactatgttgat
tctacaactatgtatgagttagaatacctcgtttatcatctacgtccatatggttattta
tacagatatcaacctaccttacctgaacatatactaaaggaaattagtcaagcaaacaaa
aatgaagatacaaaagtgaagttagaaaatccttga

DBGET integrated database retrieval system