KEGG   Pongo abelii (Sumatran orangutan): 100452548Help
Entry
100452548         CDS       T01416                                 

Gene name
GEMIN7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:pon03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 131 aa AA seqDB search
MQTPVTIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARA
ALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLR
CSDIISYTFKP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactccagtgaccattcccgtgcctgtgctccggctgccccggggccctgatggc
ttcagccgtggctttgcccctgatggacgcagagccccgttgaggccagaggttcctgaa
atccaggagtgtcccatagctcaagaatccctggaatcccaggagcagcgggcacgagcc
gcccttcgggagcgttacctccgcagcctgctggccatggtgggtcatcaggtgagcttc
acgttgcacgagggtgtgcgtgtggccgcccactttggagccaccgacctggatgtggcc
aacttctacgtgtcacagctgcagactcccataggtgtgcaagcagaggcgctgctccga
tgtagtgacattatttcatataccttcaagccgtaa

DBGET integrated database retrieval system