KEGG   Pongo abelii (Sumatran orangutan): 100452766Help
Entry
100452766         CDS       T01416                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 352 aa AA seqDB search
MEGAVKRVRGPPNSFWCLGAPPPGGVLGGPRSRRAWAEAAAAAAKAVAVRAGGPGTAAME
GQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKY
EVFRTEEEEKXKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKF
LEESVSMSPEERARYLENYDAIRVTHETSAHEGQTESSSPSSSQPHSSHCRTKASSLCHH
ASLPWVKRNHVGPAKATSPSLRLRRWRPFLRLPSLGLHSVAPSIDEKVDLHFIALVHVDG
HLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagggagcggttaagagggtgagaggcccgccaaattctttttggtgtttaggcgct
cctcctccgggcggtgtgttgggagggcccaggtcaaggcgcgcgtgggcggaagcggcg
gcggcggcggcgaaggcggtggctgtcagagctggagggccgggcaccgcggccatggag
ggtcaacgctggctgccgctggaggccaatcccgaggtcaccaaccagtttctcaaacaa
ttaggtctgcatcctaactggcaattcgtcgatgtatatggaatggatcctgaactcctt
agcatggtaccaagaccagtctgcgcagtcttacttctctttcctattacagaaaagtat
gaagtattcagaacagaagaggaagaaaaantaaaatctcagggacaagatgttacatca
tcagtatatttcatgaagcaaacaatcagcaatgcctgtggaacaattggactgattcat
gctattgcaaacaataaagacaagatgcactttgaatctgggtcaaccttgaaaaaattc
ctggaggaatctgtgtcaatgagccctgaagaacgagccagatacctggagaactatgat
gccatccgagttactcatgagaccagtgcccatgaaggtcagactgagtcctcctcgcca
tcctcatcacagcctcattctagccactgcagaacgaaggcctcatcattgtgtcaccat
gcatccctgccctgggtcaaacgtaaccatgtaggccctgcaaaggctaccagtccatct
ctccgtcttcgtcgctggcgacccttcttacgcctaccatctttgggtctccattctgtt
gcgccaagtatagatgaaaaagtagatcttcattttattgcattagttcatgtagatggg
catctctatgaattagatgggcggaaaccatttccaattaaccatggtgaaactagtgat
gaaactttattagaggatgccatagaagtttgcaagaagtttatggagcgtgaccctgat
gaactaagatttaatgcgattgctctttctgcagcatag

DBGET integrated database retrieval system