KEGG   Pongo abelii (Sumatran orangutan): 100452766Help
Entry
100452766         CDS       T01416                                 

Gene name
UCHL3
Definition
(RefSeq) ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100452766 (UCHL3)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100452766 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
13
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKXKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcaacgctggctgccgctggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctgcatcctaactggcaattcgtcgatgtatatggaatggatcctgaa
ctccttagcatggtaccaagaccagtctgcgcagtcttacttctctttcctattacagaa
aagtatgaagtattcagaacagaagaggaagaaaaantaaaatctcagggacaagatgtt
acatcatcagtatatttcatgaagcaaacaatcagcaatgcctgtggaacaattggactg
attcatgctattgcaaacaataaagacaagatgcactttgaatctgggtcaaccttgaaa
aaattcctggaggaatctgtgtcaatgagccctgaagaacgagccagatacctggagaac
tatgatgccatccgagttactcatgagaccagtgcccatgaaggtcagactgaggcgcca
agtatagatgaaaaagtagatcttcattttattgcattagttcatgtagatgggcatctc
tatgaattagatgggcggaaaccatttccaattaaccatggtgaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggagcgtgaccctgatgaacta
agatttaatgcgattgctctttctgcagcatag

DBGET integrated database retrieval system