KEGG   Pongo abelii (Sumatran orangutan): 100452870Help
Entry
100452870         CDS       T01416                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1 (pore forming protein)
  KO
K07818  
perforin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100452870 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100452870 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100452870 (PRF1)
   05330 Allograft rejection
    100452870 (PRF1)
   05332 Graft-versus-host disease
    100452870 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    100452870 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100452870 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 555 aa AA seqDB search
MAARLLLLGIVLLLLPLPIPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD
AARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYS
FHVVHTPPLHPDFKRALGDLPHHFNSSTQPAYLRLISNYGTHFIRAVELGGRISALTALR
TCELALEGLTDDEVEDCLTVEAQVNIGARGSSSAEAKACEEKKKKHKMTASFHQTYRERH
SEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREAL
RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT
FIQAWGLWGDWFTATDAYVKVFFGGQELRTSTVWSNNNPIWSVRLDFGDVLLATGGPLRL
QVWDQDSGWDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQ
MLLGEPPGNRSGAVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccgtctgctcctcctgggcatcgttctcctgctgctgcccctgcccatccct
gccccgtgccacacggccgcacgctcagagtgcaagcgcagccacaagttcgtgcctggt
gcatggctggccggggagggtgtggatgtgaccagcctccgccgctcgggctccttccca
gtggacacacaaaggttcctgcggcccgacggcacctgcaccctctgtgaaaatgcccta
caggagggcaccctccagcgcctgcctctggcactcaccaactggcgggcccagggctct
ggctgccagcgccatgtaaccagggccaaagtcagctccactgaagctgtggcccgggat
gcggctcgtagcatccgcaacgactggaaggtcgggctggatgtgactcctaagcccacc
agcaatgtgcatgtgtccgtggctggctcacactcacaggcagccaactttgcagcccag
aagacccaccaggaccagtacagcttcagcactgacacagtggagtgccgcttctatagt
ttccatgtggtacacactcccccgctacaccctgacttcaagagggccctcggggacctg
ccccaccacttcaactcctccacccagcccgcctacctcaggctcatctccaactacggc
acccacttcatccgggctgtggagctgggcggccgtatctcggccctcactgccctgcgc
acctgcgagctggccctggaagggctcacggacgacgaggtggaggactgcctgaccgtc
gaggcccaggtcaacataggtgcccgcggcagctcctctgccgaagccaaggcctgtgag
gagaagaagaagaagcacaagatgacggcctccttccaccaaacctaccgggagcgccat
tcggaagtggttggcggccatcacacttccattaacgacctgctgttcgggatccaggcc
gggcccgagcagtactcagcctgggtgaactcgctgcccggcagccctggcctggtggac
tacaccctggaacccctgcacgtgctgctggacagccaggacccgcggcgggaggcactg
aggagggccctgagtcagtacctgacggacagggctcgctggagggactgcagccggccg
tgcccgccggggcggcagaagagcccccgagacccgtgccagtgtgtgtgccatggctca
gcggtcaccacccaggactgctgccctcggcagaggggcctggcccagctggaggtgacc
ttcatccaagcatggggcctgtggggggactggttcactgccactgatgcctatgtgaag
gtgttctttggtggccaggagctgaggacgagcaccgtgtggagcaataacaaccccatc
tggtcagtgcggctggattttggggatgtgctcctggccacaggggggcccctgaggttg
caggtctgggatcaggactctggctgggatgatgacctccttggcacctgtgatcaggct
cccaagtctggttcccatgaggtgagatgcaacctgaatcatggccacctaaaattccgc
tatcatgccaggtgcttgccccacctgggaggaggcacctgcctggactacgtcccccaa
atgcttctgggggagcctccaggaaaccggagtggggctgtgtggtga

DBGET integrated database retrieval system