KEGG   Pongo abelii (Sumatran orangutan): 100453045Help
Entry
100453045         CDS       T01416                                 

Definition
histo-blood group ABO system transferase-like
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100453045
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     100453045
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     100453045
Glycosyltransferases [BR:pon01003]
 Glycan extension
  ABO blood group
   100453045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 368 aa AA seqDB search
MTQLLQTLAGNXKCSLLCVTFLLLITLLLTFFSYCYLNPQSQILKSLLAGASVALREHHG
QQVVKLSSTVYTQPDALTPSRNDVLVVTPWLAPIVWEGTFNTDLLNEQFQCQNATIGXTV
FAIKKYILFLKLFLESAETHFMGGHRVNYNIFTSQPGHVPHIKLQQGWHMVILQVRIYAH
WXDITRHRMEVVSNFPQQYFLEEVDYLVCTDVDMKFSDHVGVEILYSLFATIHPGFYGFH
QDTFAYECQPQSQAHIPEGKGDFYYIGALFGGSVLEVYRLTTVCHQAMMIDEAXLNKYLL
NHKPTKVLSPEYMWDKKLMEYMLDEHLLGLCTMIKHKGFVVLVKNEEMRTDEGSFQKETR
EGVIASQL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacccagctcctgcagacactggctggaaacnaaaaatgcagcttgctttgtgtgacc
tttcttctcctaataactctcctcttgacgttttttagctattgttacctgaacccacag
agccagatcctgaaaagcttactagctggggcaagcgtggctcttagagaacaccatggc
cagcaagttgtaaaattatcaagcacggtgtatacccagccagatgccctaacaccctcc
agaaatgatgtccttgttgtgaccccttggctggctcccattgtgtgggaggggaccttc
aacactgacctgctaaatgagcagttccagtgccagaatgccaccattggataaactgtg
tttgccataaaaaaatacatattattcctgaagctgttcctggagagtgcagaaacacac
ttcatggggggacatagggtgaactacaacatcttcaccagccagccaggtcatgttcca
cacatcaagctccaacagggatggcacatggtcatcctccaggtccggatctatgcccac
tggtaggacatcaccaggcaccgcatggaggtggtcagcaactttccccagcagtacttc
ctcgaggaggtggattaccttgtgtgcacagatgtggacatgaagttcagtgaccacgtg
ggtgtggagatcctgtattccctgtttgccaccatccatcctggcttctatgggttccat
caggacacctttgcctatgaatgccagcctcagtcccaagctcatattcctgagggtaaa
ggggacttttattacataggggccttatttggtgggtcagtgctggaggtttacaggctc
accacagtctgtcaccaggcgatgatgatcgacgaagccnnacttaacaagtacctgctt
aatcacaaacccaccaaggtcctctcccctgagtacatgtgggataaaaagttgatggag
tatatgttggatgaacacctgctgggtttgtgcaccatgataaagcacaaggggtttgtg
gtcttggtaaagaatgaggaaatgcggactgatgagggaagcttccagaaagagaccaga
gagggggtgattgccagtcagctctaa

DBGET integrated database retrieval system