KEGG   Pongo abelii (Sumatran orangutan): 100453047Help
Entry
100453047         CDS       T01416                                 

Gene name
KCNMB3
Definition
(RefSeq) potassium large conductance calcium-activated channel, subfamily M beta member 3
  KO
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100453047 (KCNMB3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100453047 (KCNMB3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100453047 (KCNMB3)
Ion channels [BR:pon04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100453047 (KCNMB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 173 aa AA seqDB search
MQPFSIPVQITLQGSRRRQGRTAFPVSGKKREXDYSDGDPLDVHKSLPSSAGEDRAMMLG
FATMGFSVLMFFLLGTTILKPFMLSIRREESTCTAILTDIMDDWLDCAFTCGVHCRGQGK
YPCLRVFVNLTHSGQKALLHYNEEAVQINPKRDVTDCRVKEKQTLTVSDEHKQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcagcatccccgtgcaaatcacacttcagggcagccggaggcgccaggga
aggacagcctttcctgtctcagggaagaagagagagnnagactacagtgatggagaccca
ctagatgtgcacaagagcctgccgtccagtgctggagaagaccgagccatgatgctgggg
tttgccacgatgggcttctcagtcctaatgttcttcttgctcggaacaaccattctaaag
ccttttatgctcagcattcggagagaagaatcgacctgcactgccatcctcacagatatc
atggacgactggctggactgtgccttcacctgtggtgtgcactgccgcggtcaggggaag
tacccgtgtcttcgggtgtttgtgaacctcacccattcaggtcagaaagctctcctacat
tataatgaagaggctgtccagataaatcccaagcgtgatgttacagactgcagagttaaa
gaaaagcagacattgacagtttctgatgagcataaacagtaa

DBGET integrated database retrieval system