KEGG   Pongo abelii (Sumatran orangutan): 100453095Help
Entry
100453095         CDS       T01416                                 

Gene name
PBK
Definition
PDZ binding kinase
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100453095 (PBK)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   100453095 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 288 aa AA seqDB search
MQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHH
PNIVGYRAFTEASDGSLCLAMEYGGEKSLNDLIEERYKASRDPFPAAIILKVALNMARGL
KYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKP
KEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAA
LGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcttggctttggtactggggtaaatgtttacctaatgaaaagatctccaaga
ggtttgtctcattctccttgggctgtaaaaaagattaatcctatatgtaatgatcattat
cgaagtgtgtatcaaaagagactaatggatgaagctaagattttgaaaagccttcatcat
ccaaacattgttggttatcgtgcttttactgaagccagtgatggcagtctgtgtcttgct
atggaatatggaggtgaaaagtctctaaatgacttaatagaagaacgatataaagccagc
cgagatccttttccagcagccataattttaaaagttgctttgaatatggcaagagggtta
aagtatctgcaccaagaaaagaaactgcttcatggagacataaagtcttcaaatgttgta
attaaaggcgattttgaaacaattaaaatctgtgatgtaggagtctctctaccactggat
gaaaatatgactgtgactgaccctgaggcttgttacattggcacagagccatggaaaccc
aaagaagctgtggaggagaatggtgttattactgacaaggcagacatatttgcctttggc
cttactttgtgggaaatgatgactttatcgattccacacattaatctttcaaatgatgat
gatgatgaagataaaacttttgatgaaagtgattttgatgatgaagcatactatgcagcc
ttgggaactaggccacctattaatatggaagaactggatgaatcataccagaaagtaatt
gaactcttctctgtatgcactaatgaagaccctaaagatcgtccttctgctgcacacatt
gttgaagctctggaaacagatgtctag

DBGET integrated database retrieval system