KEGG   Pongo abelii (Sumatran orangutan): 100453095Help
Entry
100453095         CDS       T01416                                 

Gene name
PBK
Definition
PDZ binding kinase
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 288 aa AA seqDB search
MQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHH
PNIVGYRAFTEASDGSLCLAMEYGGEKSLNDLIEERYKASRDPFPAAIILKVALNMARGL
KYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKP
KEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAA
LGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcttggctttggtactggggtaaatgtttacctaatgaaaagatctccaaga
ggtttgtctcattctccttgggctgtaaaaaagattaatcctatatgtaatgatcattat
cgaagtgtgtatcaaaagagactaatggatgaagctaagattttgaaaagccttcatcat
ccaaacattgttggttatcgtgcttttactgaagccagtgatggcagtctgtgtcttgct
atggaatatggaggtgaaaagtctctaaatgacttaatagaagaacgatataaagccagc
cgagatccttttccagcagccataattttaaaagttgctttgaatatggcaagagggtta
aagtatctgcaccaagaaaagaaactgcttcatggagacataaagtcttcaaatgttgta
attaaaggcgattttgaaacaattaaaatctgtgatgtaggagtctctctaccactggat
gaaaatatgactgtgactgaccctgaggcttgttacattggcacagagccatggaaaccc
aaagaagctgtggaggagaatggtgttattactgacaaggcagacatatttgcctttggc
cttactttgtgggaaatgatgactttatcgattccacacattaatctttcaaatgatgat
gatgatgaagataaaacttttgatgaaagtgattttgatgatgaagcatactatgcagcc
ttgggaactaggccacctattaatatggaagaactggatgaatcataccagaaagtaatt
gaactcttctctgtatgcactaatgaagaccctaaagatcgtccttctgctgcacacatt
gttgaagctctggaaacagatgtctag

DBGET integrated database retrieval system