KEGG   Pongo abelii (Sumatran orangutan): 100453198Help
Entry
100453198         CDS       T01416                                 

Definition
cytochrome P450 2D6-like
Orthology
K17712  
cytochrome P450, family 2, subfamily D, polypeptide 6 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100453198
   00982 Drug metabolism - cytochrome P450
    100453198
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100453198
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100453198
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP2 family
   100453198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 606 aa AA seqDB search
MGLEALVPLAVTVAIFLLLVDLMHRRQRWTARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ
LRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTRGEDTADRPPAPIYQVLGFGPRSQGVI
LARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEASCLCAAFADHSGRPFRPNXXLGR
SVLRTGRPWVFPGGGWGLRLVQVNAEHRKDPDPILCLVQVLNAIPVLLHIPGVAGKVLHS
QKAFLAQLDELLTEHRMIWNPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRMVVADLF
LAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQARMPYTTAVIHEV
QRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLFTNLSSVLKDEAVWEKLLPLPLRTLPGC
SGPLCEARGLPAFLSSACRVQQEIDDVIGQVRRPEMGDQACMPYTTAVIHEVQRFGDIVP
LGVTHMTSRDIEVQGFHIPKGTTLFTNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPE
AFLPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPAGQPQPSHSRVVSFLVIPSPYE
LCAVPR
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggggctagaagcactggtgcccctggccgtgacagtggccatcttcctgctcctggtg
gacctgatgcaccggcgccaacgctggactgcacgctacccaccgggccccctgccactg
cccggactgggcaacctgctgcacgtggacttccagaacacaccatactgctttgaccag
ttgcggcgccgcttcggggacgtgttcagcctgcagctggcctggacgccggtggtcgtg
ctcaatgggctggcggccgtgcgcgaggcgctggtgacccgcggcgaggacaccgccgac
cgcccgcctgcacccatctaccaggtcctgggcttcgggccgcgttcccaaggggtgatc
ctggcacgctacgggcccgcatggcgcgagcagaggcgcttctccgtgtccaccttgcgc
aacttgggcctgggcaagaagtcgctggagcagtgggtgaccgaggaggcctcctgcctc
tgtgccgccttcgccgaccactccggacgcccctttcgccccaacnnnnacttggggaga
tcagttttgaggacaggcagaccctgggttttccctggaggtggctggggcctgagactg
gtccaggtgaacgcagagcacagaaaggatccagaccccattctgtgtctggtgcaggtg
ctaaatgccatccccgtcctcctgcacatccccggggtggctggcaaggtcttacactcc
caaaaggctttcctggcccagctggatgagctgctgactgagcacaggatgatctggaac
ccagcccagccaccccgagacctaactgaggccttcctggcagagatggagaaggccaag
gggaaccctgagagcagcttcaatgatgagaacctgcgcatggtggtggctgacctgttc
cttgccgggatggtgaccacctcgaccacgctggcctggggcctcctgctcatgatccta
cacccggatgttcagcgccgtgtccaacaggagatcgacgacgtgatagggcaggtgcgg
cgaccagagatgggtgaccaggctcgcatgccctacaccactgccgtgattcacgaggtg
cagcgctttggggacatcgtccccctgggtgtgacccatatgacatcccgtgacatcgaa
gtacagggcttccgcatccctaaggggacgacgctcttcaccaacctgtcatcagtgctg
aaggacgaggccgtctgggagaagctccttccgcttccactccgaacacttcctggatgc
tcagggccactttgtgaagccagaggccttcctgcctttctcagcagtgcctgccgtgtc
caacaggagatcgacgatgtgatagggcaggtgcggcgaccagagatgggtgaccaggct
tgcatgccctacaccactgccgtgattcacgaggtgcagcgctttggggacatcgtcccc
ctgggtgtgacccatatgacatcccgtgacatcgaagtacagggcttccacattcctaag
gggacgacgctcttcaccaacctgtcatcggtgctgaaggatgaggccgtctgggagaag
cccttccgcttccaccccgaacacttcctggatgcccagggccactttgtgaagccagag
gccttcctgcctttctcagcaggccgccgcgcatgcctcggggagcccctggcccgcatg
gagctcttcctcttcttcacctgcctgctgcagcgcttcagcttctcggtgcccgctgga
cagccccagcccagccactctcgcgttgtcagctttctggtgatcccttccccctacgag
ctttgtgctgtgccccgctag

DBGET integrated database retrieval system