KEGG   Pongo abelii (Sumatran orangutan): 100453198Help
Entry
100453198         CDS       T01416                                 

Definition
cytochrome P450 2D6-like
Orthology
K17712  
cytochrome P450, family 2, subfamily D, polypeptide 6 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Serotonergic synapse
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:pon00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:pon00982]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:pon04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 606 aa AA seqDB search
MGLEALVPLAVTVAIFLLLVDLMHRRQRWTARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ
LRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTRGEDTADRPPAPIYQVLGFGPRSQGVI
LARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEASCLCAAFADHSGRPFRPNXXLGR
SVLRTGRPWVFPGGGWGLRLVQVNAEHRKDPDPILCLVQVLNAIPVLLHIPGVAGKVLHS
QKAFLAQLDELLTEHRMIWNPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRMVVADLF
LAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQARMPYTTAVIHEV
QRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLFTNLSSVLKDEAVWEKLLPLPLRTLPGC
SGPLCEARGLPAFLSSACRVQQEIDDVIGQVRRPEMGDQACMPYTTAVIHEVQRFGDIVP
LGVTHMTSRDIEVQGFHIPKGTTLFTNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPE
AFLPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPAGQPQPSHSRVVSFLVIPSPYE
LCAVPR
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggggctagaagcactggtgcccctggccgtgacagtggccatcttcctgctcctggtg
gacctgatgcaccggcgccaacgctggactgcacgctacccaccgggccccctgccactg
cccggactgggcaacctgctgcacgtggacttccagaacacaccatactgctttgaccag
ttgcggcgccgcttcggggacgtgttcagcctgcagctggcctggacgccggtggtcgtg
ctcaatgggctggcggccgtgcgcgaggcgctggtgacccgcggcgaggacaccgccgac
cgcccgcctgcacccatctaccaggtcctgggcttcgggccgcgttcccaaggggtgatc
ctggcacgctacgggcccgcatggcgcgagcagaggcgcttctccgtgtccaccttgcgc
aacttgggcctgggcaagaagtcgctggagcagtgggtgaccgaggaggcctcctgcctc
tgtgccgccttcgccgaccactccggacgcccctttcgccccaacnnnnacttggggaga
tcagttttgaggacaggcagaccctgggttttccctggaggtggctggggcctgagactg
gtccaggtgaacgcagagcacagaaaggatccagaccccattctgtgtctggtgcaggtg
ctaaatgccatccccgtcctcctgcacatccccggggtggctggcaaggtcttacactcc
caaaaggctttcctggcccagctggatgagctgctgactgagcacaggatgatctggaac
ccagcccagccaccccgagacctaactgaggccttcctggcagagatggagaaggccaag
gggaaccctgagagcagcttcaatgatgagaacctgcgcatggtggtggctgacctgttc
cttgccgggatggtgaccacctcgaccacgctggcctggggcctcctgctcatgatccta
cacccggatgttcagcgccgtgtccaacaggagatcgacgacgtgatagggcaggtgcgg
cgaccagagatgggtgaccaggctcgcatgccctacaccactgccgtgattcacgaggtg
cagcgctttggggacatcgtccccctgggtgtgacccatatgacatcccgtgacatcgaa
gtacagggcttccgcatccctaaggggacgacgctcttcaccaacctgtcatcagtgctg
aaggacgaggccgtctgggagaagctccttccgcttccactccgaacacttcctggatgc
tcagggccactttgtgaagccagaggccttcctgcctttctcagcagtgcctgccgtgtc
caacaggagatcgacgatgtgatagggcaggtgcggcgaccagagatgggtgaccaggct
tgcatgccctacaccactgccgtgattcacgaggtgcagcgctttggggacatcgtcccc
ctgggtgtgacccatatgacatcccgtgacatcgaagtacagggcttccacattcctaag
gggacgacgctcttcaccaacctgtcatcggtgctgaaggatgaggccgtctgggagaag
cccttccgcttccaccccgaacacttcctggatgcccagggccactttgtgaagccagag
gccttcctgcctttctcagcaggccgccgcgcatgcctcggggagcccctggcccgcatg
gagctcttcctcttcttcacctgcctgctgcagcgcttcagcttctcggtgcccgctgga
cagccccagcccagccactctcgcgttgtcagctttctggtgatcccttccccctacgag
ctttgtgctgtgccccgctag

DBGET integrated database retrieval system