KEGG   Pongo abelii (Sumatran orangutan): 100453198Help
Entry
100453198         CDS       T01416                                 

Definition
(RefSeq) cytochrome P450 2D6-like
  KO
K17712  cytochrome P450 family 2 subfamily D polypeptide 6 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00980  Metabolism of xenobiotics by cytochrome P450
pon00982  Drug metabolism - cytochrome P450
pon01522  Endocrine resistance
pon04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100453198
   00982 Drug metabolism - cytochrome P450
    100453198
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100453198
 Human Diseases
  Drug resistance
   01522 Endocrine resistance
    100453198
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100453198
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP2 family
   100453198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100453198
NCBI-ProteinID: XP_024095416
Position
22
AA seq 497 aa AA seqDB search
MGLEALVPLAVTVAIFLLLVDLMHRRQRWTARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ
LRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTRGEDTADRPPAPIYQVLGFGPRSQGVI
LARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEASCLCAAFADHSGRPFRPNGLLNK
AVSNVIASLTCGRRFEYDDPRFLKLLDLAQEGLKEETGFLREVLNAIPVLLHIPGVAGKV
LHSQKAFLAQLDELLTEHRMIWNPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRMVVA
DLFLAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQARMPYTTAVI
HEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLFTNLSSVLKDEAVWEKPFRFHPEHF
LDAQGHFVKPEAFLPFSAGRRTCLGEPLARMELFLFFTCLLQRFSFSVPAGQPQPSHSRV
VSFLVIPSPYELCAVPR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggggctagaagcactggtgcccctggccgtgacagtggccatcttcctgctcctggtg
gacctgatgcaccggcgccaacgctggactgcacgctacccaccgggccccctgccactg
cccggactgggcaacctgctgcacgtggacttccagaacacaccatactgctttgaccag
ttgcggcgccgcttcggggacgtgttcagcctgcagctggcctggacgccggtggtcgtg
ctcaatgggctggcggccgtgcgcgaggcgctggtgacccgcggcgaggacaccgccgac
cgcccgcctgcacccatctaccaggtcctgggcttcgggccgcgttcccaaggggtgatc
ctggcacgctacgggcccgcatggcgcgagcagaggcgcttctccgtgtccaccttgcgc
aacttgggcctgggcaagaagtcgctggagcagtgggtgaccgaggaggcctcctgcctc
tgtgccgccttcgccgaccactccggacgcccctttcgccccaacggcctcttgaacaaa
gccgtgagcaacgtgatcgcctccctcacctgtgggcgccgcttcgagtacgacgaccct
cgcttcctcaagctgctggacctagctcaggagggattgaaggaggagacgggcttcctg
cgcgaggtgctaaatgccatccccgtcctcctgcacatccccggggtggctggcaaggtc
ttacactcccaaaaggctttcctggcccagctggatgagctgctgactgagcacaggatg
atctggaacccagcccagccaccccgagacctaactgaggccttcctggcagagatggag
aaggccaaggggaaccctgagagcagcttcaatgatgagaacctgcgcatggtggtggct
gacctgttccttgccgggatggtgaccacctcgaccacgctggcctggggcctcctgctc
atgatcctacacccggatgttcagcgccgtgtccaacaggagatcgacgacgtgataggg
caggtgcggcgaccagagatgggtgaccaggctcgcatgccctacaccactgccgtgatt
cacgaggtgcagcgctttggggacatcgtccccctgggtgtgacccatatgacatcccgt
gacatcgaagtacagggcttccgcatccctaaggggacgacgctcttcaccaacctgtca
tcagtgctgaaggacgaggccgtctgggagaagcccttccgcttccaccccgaacacttc
ctggatgcccagggccactttgtgaagccagaggccttcctgcctttctcagcaggccgc
cgcacatgcctcggggagcccctggcccgcatggagctcttcctcttcttcacctgcctg
ctgcagcgcttcagcttctcggtgcccgctggacagccccagcccagccactctcgcgtt
gtcagctttctggtgatcccttccccctacgagctttgtgctgtgccccgctag

DBGET integrated database retrieval system