KEGG   Pongo abelii (Sumatran orangutan): 100453292Help
Entry
100453292         CDS       T01416                                 

Gene name
PNPLA6, NTE
Definition
patatin-like phospholipase domain containing 6 (EC:3.1.1.5)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100453292 (PNPLA6)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100453292 (PNPLA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 1365 aa AA seqDB search
MGTSSHGLATNSSGAKVAERDGFQDVPAPGEGAAGRICGAQPVPFVPQVLGVMIGAGVAV
VVTAVLILLVVRRLRVPKTPAPDGPRYRFRKRDKVLFYGRKIMRKVSQSTSSLVDTSVSA
TSRPRMKKKLKMLNIAKKILRIQKETPTLQRKEPPPAVLEADLTEGDLANSHLPSEVLYM
FKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLLELCLPGPDG
KECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEAFSAVFAKYP
ESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPTRTSPVRGSKR
MVSTSATDEPRETPGRPPDPTGAPLPGPTGDPVKPTSLETPSAPLLSRCVSMPGDISGLQ
GGPRSDFDMAYERGRISVSLQEGASGGSLAAPARTPTQEPREQPAGACEYSYCEDESATG
GCPFGPYQGRQTSSIFEAAKRELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSL
HFVLWGCLHVYQHMIDKAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISK
SDFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQGDRSDCTYIV
LNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTELAKLPEGTLG
HIKRRHPQVVTRLIHLLSQKILGNLQQLQGPFPGSGLGVPPHSELTNPASNLATVAVLPV
CAEVPMVAFTLELQHALQAIGPTLLLNSDIIRARLGASALDSIQEFRLSGWLAQQEDAHR
IVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQLEQMLENTAVRALKQLVLLHRE
EGAGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRRADRHSDFSRL
ARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSAS
RTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNRSIHRVFQDKQIEDLWLPYFNVT
TDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLPADIARSMG
AKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPDMAEIQSRLAYVSCVR
QLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQVYDVGYQYGKAVFGGWSRGNVIEKMLTDR
RSTDLNESRRADVLAYPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGP
DCSRDEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSATDA
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggggacatcgagtcacgggctggctacaaactcctcgggggcgaaggtggcggagagg
gatgggttccaggacgtcccggcgcccggggaaggcgcggcgggacggatttgcggtgcg
cagccagtgccgttcgtccctcaggtgctgggcgtgatgatcggggccggagtggcggtg
gtggtcacggccgtgctcatcctcctggtggtgcggcggctgcgagtgccaaaaacccca
gccccggatggcccccggtatcggttccggaagagggacaaagtgctgttctatggccgg
aagattatgcggaaggtgtcacaatccacctcctccctcgtggatacctctgtctccgcc
acttcccggccacgcatgaagaagaaactgaagatgctcaacattgccaagaagattctg
cgcatccagaaagagacgcccacactgcagcggaaggagcccccacccgcagtgctggaa
gctgacctgaccgagggcgacctggctaactcccatctgccctctgaagtgctttatatg
ttcaagaacgtccgggtgctgggccacttcgagaaaccgctcttcctggagctctgccgt
cacatggtcttccagcggctgggccagggtgactatgtcttccggccgggccagccagat
gccagcatctacgtggtgcaggacgggctgctggagctctgtctgccagggcctgacggg
aaggagtgtgtggtgaaggaagtggttcctggggacagcgtcaacagcctcctcagcatc
ctggatgtcatcaccggtcaccagcatccccagcggaccgtgtctgcccgggcggcccgg
gactccacggtgctgcgcctgccggtggaagcattctccgcggtcttcgccaagtacccg
gagagcttggtgcgggtcgtgcagatcatcatggtgcggctgcagcgagtcaccttcctg
gcactgcacaactacctgggtctgaccaatgagctcttcagccacgagatccagcccctg
cgtctgttccccagccctggcctcccaactcgcaccagccctgtgcggggctccaagagg
atggtcagcacctcagctacagacgagcccagggagaccccaggccggccacctgatccc
accggggccccgctgcctggacctacaggggaccccgtgaagcccacatccctggaaacc
ccctcggcccctctgctgagccgctgcgtctccatgccaggggacatctcaggcttgcag
ggtggcccccgctctgactttgacatggcctatgagcgtggccggatctccgtgtccctg
caggaaggggcgtctggggggtccctggcagcccccgctcggacccccactcaggagcct
cgtgagcagccggcaggcgcctgtgaatacagttactgtgaggatgagtcggccaccggt
ggctgccctttcgggccctaccagggccgccagaccagcagcatcttcgaggcagcaaag
cgggagctggccaagctgatgcggattgaggacccctccctcctgaacagccgagtcttg
ctgcaccacgccaaagccggcaccatcattgcccgccagggagaccaggacgtgagcctg
cacttcgtgctctggggctgcctacacgtgtaccagcacatgatcgacaaggcggaggac
gtgtgcctgttcgtagcgcagcccggggaactggtggggcagctggcggtgctcactggc
gaacctctcatcttcacactgcgagcccaacgcgactgcaccttccttcggatctccaag
tccgatttctatgagatcatgcgcgcacagcccagtgtggtgctgagcgcggcgcacacg
gtggcagccaggatgtcgcccttcgtgcgccagatggacttcgccatcgactggactgca
gtggaggcgggacgcgcgctgtacaggcagggcgaccgctccgactgcacttacatcgtg
ctcaatgggcggctgcgtagcgtgatccagcgaggcagcggcaagaaggagctggtgggc
gagtacggccgcggcgacctcatcggcgtggtggaggcactgacgcggcagccgcgagcc
acgacggtgcacgcggtgcgcgacacggagctggccaagcttcccgagggcaccttgggt
cacatcaaacgccggcacccgcaggtcgtgacccgccttatccacctactgagccagaaa
attctagggaatttgcagcagctgcaaggacccttcccaggctccgggctgggtgtgccc
ccacactcggaactcaccaacccagccagcaacctggcaactgtggcagtcctgcctgtg
tgtgctgaggtccccatggtggccttcacgctggagctgcagcacgccctgcaggccatc
ggtccgacgctactccttaacagtgacatcatccgggcacgcctgggggcctccgcactg
gatagcatccaagagttccggctgtcagggtggctggcccagcaggaggatgcacaccgt
atcgtactctaccagacggacgcctcgctgacgccctggaccgtgcgctgcctgcgacag
gccgactgtatcctcatcgtgggcctgggggaccaggagcccaccctcggccagctggag
cagatgctggagaacacggctgtgcgcgcccttaagcagctggtcctgctccaccgagag
gagggcgcgggccccacgcgcaccgtggagtggctaaatatgcgcagctggtgctcgggg
cacctgcacctgcgctgtccgcgccgcctcttttcgcgccgcagccctgccaagctgcat
gagctctacgagaaggttttctccaggcgcgcggaccggcacagcgacttctcccgcttg
gcgagggtgctcacagggaacaccattgcccttgtgctgggcgggggcggggccaggggc
tgctcgcacatcggagtactaaaggcattagaggaggcgggggtccccgtggacctggtg
ggcggcacgtccattggctctttcatcggtgcgctgtacgccgaggaacgcagcgccagc
cgcacgaagcagcgggcccgggagtgggccaagagcatgacttcggtgctggaacctgtg
ttggacctcacgtacccagtcacctccatgttcactgggtctgcctttaaccgcagcatc
caccgggtcttccaggataagcagattgaggacctgtggctgccttacttcaacgtgacc
acagatatcaccgcctcagccatgcgagtccacaaagatggctccctgtggcggtatgtg
cgcgccagcatgacgctgtcgggctacctgcccccgctgtgcgaccccaaggatgggcac
ctactcatggatggcggctacatcaacaatctgccagcggacatcgcccgcagcatgggt
gccaaaacggtcatcgccatcgacgtggggagccaggatgagacagacctcagcacctac
ggggacagcctgtccggctggtggctgctgtggaagcggctgaatccctgggcggacaag
gtgaaggttccagacatggccgaaatccagtcccgcctggcctacgtgtcctgcgtgcgg
cagctagaggttgtcaagtccagctcctactgcgagtacctgcgcccgcccatcgactgc
ttcaagaccatggacttcgggaaattcgaccaggtctatgatgtgggctaccagtacggg
aaggcggtatttggaggctggagccgtggcaacgtcattgagaaaatgctcacagaccgg
cggtctacagaccttaatgagagccgccgtgcagatgtgcttgcctacccaagctctggc
ttcaccgacttggcagagattgtgtcccggattgagccccccacgagctatgtctctgat
ggctgtgctgacggagaggagtcagattgtctgacagagtatgaggaggacgccggaccc
gactgctcgagggatgaaggggggtcccccgagggcgcaagccccagcactgcctccgag
atggaggaggagaagtcgattctccggcaacgacgctgtctgccccaggagccgcccggc
tcagccacagatgcctga

DBGET integrated database retrieval system