KEGG   Pongo abelii (Sumatran orangutan): 100453710Help
Entry
100453710         CDS       T01416                                 

Gene name
IMPAD1
Definition
inositol monophosphatase domain containing 1
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pon00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pon00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:pon04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 359 aa AA seqDB search
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSFFGLGGEPGGGAAGPAAAADGGT
VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
LKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ
EYTEDLRKYVTTMVCVAVNGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSYNEKTPRIV
VSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWD
ICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctcccatgggcatccgcctttccccactgggggtggccgtgttttgcctgctgggg
ctcggcgtgctctaccacctctactcgggcttcttggccggccgcttcagcttcttcggc
ctgggcggcgagcctggcggcggcgcggcggggcccgcggccgcggccgacgggggcacc
gtggacttgcgcgagatgctggctgtgtcagtgctggccgcagtccgcggcggcgacgag
gtgaggcgcgtccgcgagagcaacgtcctccacgagaagtccaaggggaagacgcgcgag
ggagccgaggacaagatgaccagcggcgacgtgctgtccaaccgcaagatgttctacctg
ctcaagaccgccttccccagcgtccagattaatactgaggaacacgtggatgcagctgat
caggaggttatcttgtgggatcataagattcctgaggatattctaaaggaagtaactact
cctaaagaggtaccagcagaaagtgttactgtctggattgacccacttgatgctacacag
gaatatacagaggatcttcgaaagtacgtcactactatggtgtgtgtggctgtaaatggt
aaacccatgctaggagttatacataagccattttccgaatatacagcttgggcaatggta
gatggtggttcaaatgtgaaagcccgctcttcctacaatgagaagaccccaaggatcgtt
gtgtctcgttcccattcagggatggtcaaacaggtcgctcttcagacttttggaaaccag
actacaattatcccagctggtggtgctggttataaagttttagcacttttggatgtgcct
gataagagtcaagaaaaagctgatttatatatccatgtgacatacatcaaaaagtgggat
atatgtgctggtaatgccatcttaaaagccctaggggggcatatgactaccctgagtggt
gaagaaatcagttacactggttcagacggcattgaagggggactccttgctagcatcaga
atgaaccaccaggccctggtgagaaaactcccagatctagaaaagacaggacataaataa

DBGET integrated database retrieval system