KEGG   Pongo abelii (Sumatran orangutan): 100453741Help
Entry
100453741         CDS       T01416                                 

Gene name
PTPN7
Definition
protein tyrosine phosphatase, non-receptor type 7
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100453741 (PTPN7)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100453741 (PTPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 434 aa AA seqDB search
MNRLGCWPARSLPRSGRGSGQRSLGLGGYPSGPRHPGTPAAKRTWESPGVRARDCPLSTS
WLSEPHLGPAPYPSMVQAHGGRSRAQPLTLSLGAAMTQPPPAKTPAKKHVRLQERRGSNV
ALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPS
NFISPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYI
ATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGEEKCVHYWPTEEETYGPFQIRIQDMK
ECTEYTVRQLTIQYQEECRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAARPGP
IVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHT
LALYAGQLPEEPSP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggctgggctgctggcccgcaaggagcctgccaaggtcaggcaggggcagtggg
cagaggagtcttggacttgggggctacccttcaggtcccaggcatccaggcaccccagca
gcgaagaggacatgggagtcccccggtgtgagggccagagactgtccactgtctacctca
tggctgagtgagcctcacttgggcccagcaccctaccccagcatggtccaagcccatggg
gggcgctccagagcacagccgctgaccttgtctttgggggcagccatgacccagcctccg
cctgccaaaacgccagccaagaagcatgtgcggctgcaggagaggcggggctccaatgtg
gctctgatgctggacgttcggtccctgggggccgtagaacccatttgctccgtgaacaca
ccccgggaggtcaccctacactttctgcgcactgctggacacccccttacccgctgggcc
cttcagcgccagccacccagccccaagcaactggaagaagaattcttgaagatcccttca
aactttatcagccccgaagacctggacatccctggccacgcctccaaggaccgatacaag
accatcttgccaaatccccagagccgtgtctgtctaggccgggcacagagccaggaggac
ggagattacatcaatgccaactacatccgaggctatgatgggaaggagaaggtctacatt
gccacccagggccccatgcccaacactgtgtcggacttctgggagatggtgtggcaagag
gaagtgtccctcattgtcatgctcactcaactccgagagggcgaggagaaatgtgtccac
tactggcccacagaagaggaaacctatggacccttccagatccgcatccaggacatgaaa
gagtgcacagaatacactgtgcggcagcttaccatccagtaccaggaagagtgccggtca
gtaaagcacatcctcttctcggcctggcccgaccaccagacaccagaatcagctgggccc
ctgctgcgcctagtggcagaggtggaggagagcccggagacagccgcccgccccgggccc
atcgtagtccactgcagtgcagggattggccggacgggctgcttcatcgccacacgaatt
ggctgtcaacagctgaaagcccgaggggaagtggacattctgggtattgtgtgccaactg
cggctagacagaggggggatgatccagacggcagagcagtaccagttcctgcaccacact
ttggccctgtatgcaggccagctgcccgaggaacccagcccctga

DBGET integrated database retrieval system