KEGG   Pongo abelii (Sumatran orangutan): 100453765Help
Entry
100453765         CDS       T01416                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase 2 isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100453765 (G6PC2)
   00052 Galactose metabolism
    100453765 (G6PC2)
   00500 Starch and sucrose metabolism
    100453765 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100453765 (G6PC2)
   04151 PI3K-Akt signaling pathway
    100453765 (G6PC2)
   04152 AMPK signaling pathway
    100453765 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100453765 (G6PC2)
   04922 Glucagon signaling pathway
    100453765 (G6PC2)
   04920 Adipocytokine signaling pathway
    100453765 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100453765 (G6PC2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100453765 (G6PC2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100453765 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 100453765
NCBI-ProteinID: XP_002812607
Ensembl: ENSPPYG00000012907
UniProt: H2P7R0
Position
2B
AA seq 355 aa AA seqDB search
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLWFQLNQTVGTKMIWV
AVIGDWFNLIFKWILFGDRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFALGFYLLLRLLNIDLLWSVSVAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNSYTLSFRLLCALTS
LTTLQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYCVHMLMKQSGKKIQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcacaggaatggagtgctcataattcagcatttgcagaaggactaccga
gcttactatacttttctaaattttatgtccaatgttggagacccccggaatatctttttc
atttattttccactttggtttcaacttaatcagacagttggaaccaagatgatatgggta
gcagtcattggggattggttcaatcttatatttaaatggatattatttggtgatcgacct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccctactacatgcgaaacaggtccaggaagtccatctggccatgcaatgggctcgtcc
tgtgtctggtatgtcatggtaaccgctgccctgagccacactgtctgtgggatggataag
ttctctatcactctgcacagactgacctggtcatttctttggagtgttttttggttgatt
caaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcatgctggtggcagaggcctttgaacacactccaggcatccaa
acggccagtctgggcacatacctgaagaccaacctcttcctcttcctgtttgcacttggc
ttttacctgcttcttagactgctcaacattgacctgctgtggtccgtgtccgtagccaaa
aagtggtgtgccaaccccgactggatccacattgataccacgccttttgctggactcgtg
agaaacctcggggtcctgtttggcttgggctttgcaatcaactcggagatgttcctgctg
agctgccgaggaggaaatagctacacactgagcttccggttgctctgtgccttgacctcg
ttgaccacactgcagctctaccatttcctccagatcccgactcacgaagagcatttattt
tacgtgctgtctttttgtaaaagtgcatccattcccctaactgtagttgctttcattccc
tactgtgttcatatgttaatgaaacaaagtggaaagaagattcagtag

DBGET integrated database retrieval system