KEGG   Pongo abelii (Sumatran orangutan): 100453856Help
Entry
100453856         CDS       T01416                                 

Gene name
GLS2
Definition
glutaminase 2 (liver, mitochondrial)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100453856 (GLS2)
   00330 Arginine and proline metabolism
    100453856 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100453856 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100453856 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    100453856 (GLS2)
   04727 GABAergic synapse
    100453856 (GLS2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100453856 (GLS2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100453856 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 602 aa AA seqDB search
MRSMKALQKALSRAGSHCGRGGWGHLSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQ
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKELTGGKVT
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGA
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatgaaggctctgcagaaggccctgagccgggccggcagtcactgcgggcga
ggaggctggggtcacctgagccggagccccctccttggcgggggcgtccggcaccacctc
agtgaggccgcggcgcagggcagagagacgccacacagccaccagccgcagcaccaggat
catgattcatcagaaagtggcatgctgtcccgcctgggtgatttgctcttttacactatt
gctgaaggacaggaacgaatccctatccacaagttcaccactgcactaaaggccactgga
ctgcagacatcagatcctcggctccgagactgcatgagcgagatgcaccgcgtggtccaa
gagtccagtagtggtggcctcttggaccgagatctcttccgaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgggccatgtggatcgcatctttgaggatgccaaagagctcactggaggcaaagtgaca
gcctacatccctcagctggccaagtcaaacccagacctgtggggtgtctccctgtgcact
gtggatggtcagcggcactctgtgggccacacaaagatccccttctgcctgcagtcctgt
gtgaagcccctcacctatgccatctccataagcaccctaggcactgactacgtgcacaag
tttgtgggcaaagagccaagtggcctgcgctacaacaagctctccctcaatgaggaagga
atcccccataaccccatggtcaatgctggtgccattgttgtcagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtgttgcagtatctcaacaaaatggctggg
aatgaatacatgggtttcagcaatgccacattccagtcagagaaggaaacaggggatcgg
aattatgccatcggctattatctcaaggaaaagaagtgctttcctaagggggtggacatg
atggctgcccttgatctctacttccagctgtgctctgtggaggtcacttgtgaatcaggc
agtgtcatggcagccaccctcgccaatggtgggatctgccccatcacaggcgagagtgtg
ctgagtgctgaagcagtgcgcaacaccctcagcctcatgcattcctgcggcatgtatgac
ttctctggccagtttgccttccacgtgggcctgccagccaagtcagctgtatcaggagcc
atcctcctggtggtacccaatgtcatgggaatgatgtgcctgtcacccccattggacaag
ctggggaacagccacagggggaccagcttctgccagaagttggtgtctctcttcaatttc
cacaactatgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggca
gaagttcggaacaagactgtggtcaacctgttatttgctgcctatagtggcgatgtctca
gctcttcgaaggtttgccttgtcagccatggatatggaacagaaagactatgactcgcgc
acagctctgcatgttgctgcagctgaaggacacatcgaagttgttaaattcctgatcgag
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacattcccctggatgatgct
gtgcagttcaaccatctggaggtggtcaaactgcttcaagattaccaggactcctacaca
ctctctgagactcaggctgaggcagcagctgaggccctgtccaaagagaacttagaaagc
atggtatga

DBGET integrated database retrieval system