KEGG   Pongo abelii (Sumatran orangutan): 100454013Help
Entry
100454013         CDS       T01416                                 

Gene name
SRD5A2
Definition
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100454013 (SRD5A2)
 Human Diseases
  Cancers
   05215 Prostate cancer
    100454013 (SRD5A2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100454013 (SRD5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2A
AA seq 175 aa AA seqDB search
MFFFNSGSQPFLPVCPRTFVYSLLNRGRPYPAILILRGIAFCTGNGVLQGYYLIYCAEYP
DGWYTDIRGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIE
WIGYALATWSLPATCLLHFSHFVSLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctttaacagtggatcccaacctttcctccctgtgtgtcccaggacatttgtg
tactcactgctcaatcgagggaggccttatccagctatactcattctcagaggcattgcc
ttctgcactggaaatggagtccttcaaggctactatctgatttattgtgctgaataccct
gatgggtggtacacagacatacggggtgtcttcttatttattttgggaatgggaatcaac
attcatagtgactatatattgcgccagctcaggaagcctggagaaatcagctacaggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttcctcggtgagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcaacttgccttttgcatttttct
cactttgtttccttgggcctgcgagcttttcaccaccataggttctacctcaagatgttt
gaggactaccccaaatctcggaaagcccttattccattcatcttttaa

DBGET integrated database retrieval system