KEGG   Pongo abelii (Sumatran orangutan): 100454129Help
Entry
100454129         CDS       T01416                                 

Gene name
BCMO1
Definition
(RefSeq) beta,beta-carotene 15,15'-monooxygenase
  KO
K00515  
beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100454129 (BCMO1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     100454129 (BCMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
16
AA seq 340 aa AA seqDB search
GKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFGVTENYVIFLEQPFRLDILKMATAYIRR
MSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTDAMVVFHHVNAYEEDGCIVFDVIAYE
DNSLYQLFYLANLNQDFKENSRLTSVPTLKRFAVPLHVDKNAEVGSNLIKVASTTAMALK
EEDGQVYCQPEFLHEGLELPRVNYAHNGKQYRYVFAAGVQWSPIPTKIIKYDILTKSSLK
WREDDCWPAEPLFVPTPGAKDEDDGVILSAIVSTDPQKLPFLLILDAKSFTELARASVDV
DMHMDLHGLFITDMDWDTKKQAASEEQRDLASNCHGAPPT
NT seq 1025 nt NT seq  +upstreamnt  +downstreamnt
agggcaagaagcaggggaagagcccctggaagcacacagaggtgttctgctccatcccgt
cccgctccctgctctccccaagctactaccacagctttggagtcaccgagaactatgtca
tcttccttgagcagcctttcaggttggatattctcaagatggcaaccgcatacatccgga
gaatgagctgggcctcctgcctagctttccacagggaggagaagacttatatccacatca
tcgaccaaaggaccaggcagcctgtgcagaccaagttttacacagatgccatggtggtct
tccatcacgtcaacgcctacgaagaggacggctgcatcgtgtttgatgtcattgcctacg
aggacaacagcctctaccagctcttctacctggccaacctgaaccaggacttcaaggaga
actccaggctcacctcggtccccaccctcaagaggtttgccgtgcccctccacgtggaca
agaatgcagaagtgggctcaaatttaatcaaagtggcatctacaacagccatggccctga
aggaagaagatggccaagtctactgccagccggaatttcttcatgaaggcttagagcttc
cacgggtcaattatgctcacaatggaaagcaataccgatatgtctttgctgcaggagttc
aatggagtccaatcccaactaagataataaaatatgacattctcacaaagtcatccttaa
aatggagagaggacgactgctggccagcggaacccctgtttgtgcccacgccaggtgcca
aggatgaggatgacggagtaatcttatcagccattgtctctactgatccccaaaagctgc
cttttctgctcattctggatgccaaaagctttacagaattggcccgtgcctctgttgatg
tcgatatgcacatggatctccatggattattcattacagacatggactgggacacaaaaa
agcaggccgcttctgaggaacagagggacctggcttccaactgccacggggctcctccga
cctga

DBGET integrated database retrieval system