KEGG   Pongo abelii (Sumatran orangutan): 100454172Help
Entry
100454172         CDS       T01416                                 

Gene name
KCNMB1
Definition
(RefSeq) calcium-activated potassium channel subunit beta-1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100454172 (KCNMB1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100454172 (KCNMB1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100454172 (KCNMB1)
Ion channels [BR:pon04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100454172 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaKB RE_LlaMI UL41A
Motif
Other DBs
NCBI-GeneID: 100454172
NCBI-ProteinID: XP_002816219
Ensembl: ENSPPYG00000016033
UniProt: H2PHC2
Position
5
AA seq 191 aa AA seqDB search
MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNI
RDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSLDNYQTARADV
EKVRAKFQERQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKS
NQYLSILAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaagctggtgatggcccagaagcggggagagacacgagccctttgcctgggt
gtaaccatggtggtgtgtgccgtcatcacctactacatcctggtcacgactgtgctgccc
ctctaccagaaaagcgtgtggacccaggaatctaagtgtcacctgattgagaccaacatc
agggaccaggaggagctgaagggcaagaaggtgccccagtacccatgcctgtgggtcaac
gtgtcagctgcgggcaggtgggctgtgctgtaccacacggaggacactcgggaccagaac
cagcagtgctcctacatcccaggcagcctggacaactaccagacggcccgggccgacgtg
gagaaggtcagagccaaattccaagagcggcaggtcttctactgcttctccgcacctcgg
gggaacgaaaccagcgtcctattccagcgcctctatgggccccaggccctcctcttctcc
ctcttctggcccaccttcctgctgaccggtggcctcctcattattgccatggtgaagagc
aaccagtacctgtccatcctggcggcccagaagtag

DBGET integrated database retrieval system