KEGG   Pongo abelii (Sumatran orangutan): 100454247Help
Entry
100454247         CDS       T01416                                 

Gene name
USP3
Definition
ubiquitin specific peptidase 3
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 476 aa AA seqDB search
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGSYRCDDFVVN
DTKLGLVQKVREHLQNLENSAFTADRHRKRKLLENSTLNSKLLKVNGSTTAICATGLRNL
GNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRK
TLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVS
RSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDI
PSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLP
KVLCLHLKRFHWTAYLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHG
SGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVERQAKAGSDKL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccacacctgagctccagcgtctgcattgctccggactcagccaagttcccc
aacggctccccgtcgtcctggtgctgcagcgtgtgccggtccaacaaaagcccttgggtc
tgtttgacttgttcaagtgttcactgtggaagttatcgctgtgatgattttgtggttaat
gacaccaagctgggactggtacagaaagtcagagaacacttacagaacttggaaaactca
gctttcacagctgacaggcataggaaaagaaaacttttggaaaactcaacactaaacagc
aagttattaaaagtaaatggaagcaccactgctatttgtgccacaggccttcggaatttg
gggaacacatgtttcatgaatgccatccttcagtcactcagtaacattgagcagttttgc
tgttatttcaaagaactgcccgctgtggagttaaggaatgggaaaacagcaggaaggcgg
acataccacaccaggagccaaggggataacaatgtgtctttggtagaagagtttagaaag
acactctgtgctttatggcaaggcagccagactgcatttagcccagagtccttattttat
gttgtttggaagattatgccaaactttaggggctatcaacagcaggacgcccatgaattc
atgcgctaccttttggaccacctacacttggaactccagggcggtttcaacggtgtttcc
cgctcggcaattctgcaggagaattctactctgtctgcaagtaacaagtgttgcataaat
ggagcatctactgttgtcacggctatattcggaggcattctccaaaatgaggttaactgc
ctcatatgtgggacagaatctagaaagtttgatccattcctagacctttcattagatatt
ccaagtcagttcagaagtaagcgctctaagaatcaagaaaatggaccagtttgttcgtta
cgagattgtcttcgcagttttaccgacttagaagaacttgatgagacagagttatatatg
tgccataaatgcaaaaagaaacaaaagtccacaaaaaagttttggattcaaaaactaccc
aaggtgctatgcttacatttgaaaagatttcactggacagcatatttaagaaataaagtt
gatacatatgtagaatttccactgagaggcctagacatgaaatgctacttactagagcct
gagaacagtggcccggagagctgcctgtatgacctcgccgctgtggtggtgcaccatggt
tccggggttggttctggacattacacagcatacgcaactcacgaaggccgctggttccac
ttcaatgacagtactgtaacactgactgacgaggagactgtggtgaaggcgaaggcctac
atccttttctacgtggaacgccaggccaaagctggatcggataaactttaa

DBGET integrated database retrieval system