KEGG   Pongo abelii (Sumatran orangutan): 100454247Help
Entry
100454247         CDS       T01416                                 

Gene name
USP3
Definition
(RefSeq) ubiquitin specific peptidase 3
  KO
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100454247 (USP3)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100454247 (USP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 520 aa AA seqDB search
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQVPLTNHKKSEKQDKAQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTADRHRKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNI
EQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK
CCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGP
VCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEG
RWFHFNDSTVTLTDEETVVKAKAYILFYVERQAKAGSDKL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccacacctgagctccagcgtctgcattgctccggactcagccaagttcccc
aacggctccccgtcgtcctggtgctgcagcgtgtgccggtccaacaaaagcccttgggtc
tgtttgacttgttcaagtgttcactgtggaaggtatgtgaatggccatgcaaaaaaacat
tatgaagatgcacaagtacccttaaccaaccataagaaatcagaaaagcaagataaagct
cagcacacagtatgtatggattgcagtagctacagtacatactgttatcgctgtgatgat
tttgtggttaatgacaccaagctgggactggtacagaaagtcagagaacacttacagaac
ttggaaaactcagctttcacagctgacaggcataggaaaagaaaacttttggaaaactca
acactaaacagcaagttattaaaagtaaatggaagcaccactgctatttgtgccacaggc
cttcggaatttggggaacacatgtttcatgaatgccatccttcagtcactcagtaacatt
gagcagttttgctgttatttcaaagaactgcccgctgtggagttaaggaatgggaaaaca
gcaggaaggcggacataccacaccaggagccaaggggataacaatgtgtctttggtagaa
gagtttagaaagacactctgtgctttatggcaaggcagccagactgcatttagcccagag
tccttattttatgttgtttggaagattatgccaaactttaggggctatcaacagcaggac
gcccatgaattcatgcgctaccttttggaccacctacacttggaactccagggcggtttc
aacggtgtttcccgctcggcaattctgcaggagaattctactctgtctgcaagtaacaag
tgttgcataaatggagcatctactgttgtcacggctatattcggaggcattctccaaaat
gaggttaactgcctcatatgtgggacagaatctagaaagtttgatccattcctagacctt
tcattagatattccaagtcagttcagaagtaagcgctctaagaatcaagaaaatggacca
gtttgttcgttacgagattgtcttcgcagttttaccgacttagaagaacttgatgagaca
gagttatatatgtgccataaatgcaaaaagaaacaaaagtccacaaaaaagttttggatt
caaaaactacccaaggtgctatgcttacatttgaaaagatttcactggacagcatattta
agaaataaagttgatacatatgtagaatttccactgagaggcctagacatgaaatgctac
ttactagagcctgagaacagtggcccggagagctgcctgtatgacctcgccgctgtggtg
gtgcaccatggttccggggttggttctggacattacacagcatacgcaactcacgaaggc
cgctggttccacttcaatgacagtactgtaacactgactgacgaggagactgtggtgaag
gcgaaggcctacatccttttctacgtggaacgccaggccaaagctggatcggataaactt
taa

DBGET integrated database retrieval system