KEGG   Pongo abelii (Sumatran orangutan): 100455168Help
Entry
100455168         CDS       T01416                                 

Gene name
ELP3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100455168 (ELP3)
Transfer RNA biogenesis [BR:pon03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100455168 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 547 aa AA seqDB search
MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDI
IAAVPPQYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGP
YMVKMLK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaagcggaaaggagatctcagccctgctgagctgatgatgctgactatagga
gatgttattaaacaactgattgaagcccacgagcaggggaaagacatcgatctaaataag
gtgaaaaccaagacagccgccaaatatggcctttccgcccagccccgcctggtggatatc
attgctgccgtccctcctcagtatcgcaaggtcttggttcccaagttaaaagcgaaaccc
atcagaactgccagtgggattgctgttgtggctgtgatgtgcaaaccccacagatgtcca
cacatcagttttacaggaaatatatgtgtatactgccctggtggacctgattctgatttt
gagtattctacccagtcttacactggctatgagccaacctccatgagagctatccgtgcg
agatatgaccctttcctacagacaagacaccgaatagaacagttaaaacaacttggtcat
agtgtggataaagtggagtttattgtgatgggtggaacgtttatggcccttccagaagaa
tacagagattattttattcgaaatttacatgatgccttatcaggacatacttccaacaat
atttacgaggcagtcaagtattctgagagaagcctcacaaagtgtattggaattactatt
gaaaccagaccagattactgcatgaagcggcatttaagtgacatgttgacctatggctgc
acaaggctggagattggggtgcagagtgtttatgaagatgtggctagagacaccaacaga
ggccacactgtgaaggcagtctgtgagtcatttcacctggccaaagattccggtttcaaa
gtggtggcccatatgatgcctgacctgccaaatgtgggactagaaagagacattgaacag
ttcacagagttttttgagaaccctgcttttcgtcccgatggtctgaaactctatcctacc
ctggtgattcgtgggaccgggctttatgagctttggaaatcaggaagatataagagttac
tctcctagtgacctggtcgaattggtggctcggatcctagccctcgtgcctccatggact
cgagtgtaccgagtgcagagggatattccaatgcctttagttagctcaggagtagagcat
ggtaacctgagagagctggcacttgcaagaatgaaagacctcggaatacagtgtcgagat
gtgagaaccagagaagttggaatccaagaaattcatcacaaagtacggccataccaggtt
gaattggtaagaagagattatgttgcaaatggtggctgggaaacattcttgtcatacgaa
gacccagatcaagacattttgattggcctcctacgattacgcaagtgttcagaggaaact
ttccgtttcgaattgggtggaggtgtctccatagtacgagagctgcatgtgtatggaagt
gtggtccctgtgagcagccgggatcctactaaatttcagcatcagggatttggcatgctg
ctgatggaggaagcagaaagaatagctagagaagaacatgggtctgggaaaatcgctgtg
atatcaggggtcggcaccaggaattattatagaaagatcggctacagattacaaggcccg
tacatggtgaagatgctgaaatag

DBGET integrated database retrieval system