KEGG   Pongo abelii (Sumatran orangutan): 100455260Help
Entry
100455260         CDS       T01416                                 

Gene name
EP300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100455260 (EP300)
   04330 Notch signaling pathway
    100455260 (EP300)
   04350 TGF-beta signaling pathway
    100455260 (EP300)
   04630 Jak-STAT signaling pathway
    100455260 (EP300)
   04066 HIF-1 signaling pathway
    100455260 (EP300)
   04068 FoxO signaling pathway
    100455260 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100455260 (EP300)
  Cell communication
   04520 Adherens junction
    100455260 (EP300)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100455260 (EP300)
   04916 Melanogenesis
    100455260 (EP300)
  Nervous system
   04720 Long-term potentiation
    100455260 (EP300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100455260 (EP300)
   05206 MicroRNAs in cancer
    100455260 (EP300)
   05203 Viral carcinogenesis
    100455260 (EP300)
   05211 Renal cell carcinoma
    100455260 (EP300)
   05215 Prostate cancer
    100455260 (EP300)
  Neurodegenerative diseases
   05016 Huntington's disease
    100455260 (EP300)
  Infectious diseases
   05152 Tuberculosis
    100455260 (EP300)
   05166 HTLV-I infection
    100455260 (EP300)
   05164 Influenza A
    100455260 (EP300)
   05161 Hepatitis B
    100455260 (EP300)
   05168 Herpes simplex infection
    100455260 (EP300)
   05169 Epstein-Barr virus infection
    100455260 (EP300)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100455260 (EP300)
Transcription factors [BR:pon03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100455260 (EP300)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100455260 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 2410 aa AA seqDB search
MAGHLTVHKMFPFTTEHLFNSLRAGSAVIPPSANFGSLFDLEHDLPDELINSTELGLTNG
GDINQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGSGQVMASQAQQNSPGLGLI
NSMVKSPMTQAGLTSPNMGMGTSGPNQGPAQSTGMMNSPVNQPAMGMNTGMNAGMNPGML
AAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRG
PQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLPPFAMDKKTVPGGG
MPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQAN
GEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK
NAGDKRNQQPILTGAPVGLGNPSSLGVGQQSTPNLSTVSQIDPSSIERAYAALGLPYQVN
QMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAIN
SQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPA
ALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNML
PNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPTMIRGSVPNQMMPRITPQSGLNQFGQM
SMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVT
NIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSR
TPTPHHTPPNIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQ
PSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTS
STEVNSQAIPEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTE
LKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQP
VDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRV
YKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRY
HFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQIC
VLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPES
GEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHV
QEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWAC
PPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSA
KELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSK
NKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPL
IPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTICMLVELHTQSQDRFVYTCNECKHHVE
TRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRC
IQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQE
NKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTP
TGQQPATPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPL
PGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSG
HLEPGMGPTGMQQQPPWGQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGV
SPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNSQ
PIPGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQA
QQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQ
QRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHM
LPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQT
SSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNS
NLSQSTLDIH
NT seq 7233 nt NT seq  +upstreamnt  +downstreamnt
atggctggccatctgacagtccacaagatgttcccttttactacggagcatctctttaac
tccctgagagcaggctcagccgtcatccctccatctgccaattttggctctctatttgac
ttggagcatgacttaccagatgaattaatcaactctacagaattgggactaaccaatggt
ggtgatattaatcagcttcagacaagtcttggcatagtacaagatgcagcttctaaacat
aaacagctgtcagaattgctgcgatctggtagttcccctaacctcaatatgggagttggt
ggctcaggtcaagtcatggccagccaggcccaacagaacagtcctggattaggtttgata
aatagcatggtcaaaagcccaatgacacaggcaggcttgacttctcccaacatggggatg
ggcactagtggaccaaatcagggtcctgcgcagtcaacaggtatgatgaacagtccagta
aatcagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttg
gctgcaggcaatggacaagggataatgcctaatcaagtcatgaacggttcaattggagca
ggccgagggcgacagaatatgcagtacccaaacccaggcatgggaagtgctggcaactta
ctgactgagcctcttcagcagggctctccccagatgggaggacaaacaggattgagaggc
ccccagcctcttaagatgggaatgatgaacaaccccaatccttatggttcaccatatact
cagaatcctggacagcagattggtgccagtggccttggtctccagattcagacaaaaact
gtactatcaaataacttacctccatttgctatggacaaaaagacagttcctggtggagga
atgcccaacatgggtcaacagccagccccgcaggtccagcagccaggcctggtcactcca
gttgcccaagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatc
cagcagcaacttgttctccttttgcatgctcacaagtgccagcgccgggaacaggccaat
ggggaagtgaggcagtgcaaccttccccactgtcgcacaatgaagaatgtcctaaaccac
atgacacactgccagtcaggcaagtcttgccaagtggcacactgtgcatcttctcgacaa
atcatttcacactggaagaattgtacaagacatgattgtcctgtgtgtctccccctcaaa
aatgctggtgataagagaaatcaacagccaattttgactggagcacccgttggacttgga
aatcctagctctctaggggtgggtcaacagtctacccccaacctaagcactgttagtcag
attgatcccagctctatagaaagagcctatgcagctcttggactaccctatcaagtaaat
cagatgccgacacaaccccaggtgcaagcaaagaaccagcagaatcagcagcctgggcag
tctccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatgga
ggtgtaggagttcaaacgccgagtcttctttctgactcaatgttgcattcagccataaat
tctcaaaacccaatgatgagtgaaaatgccagtgtgccctccctgggtcctatgccaaca
gcagctcaaccatccactactggaattcggaaacagtggcatgaagatattactcaggat
cttcgaaatcatcttgttcacaaactcgtccaagccatatttcctacaccggatcctgct
gctttaaaagacagacggatggaaaacctagttgcatatgctcggaaagtcgaaggggac
atgtatgaatctgcaaacaatcgagcggaatactaccaccttctagctgagaaaatctat
aagatccagaaagaactagaagaaaaacgaaggaccagactacagaagcagaacatgcta
ccaaatgctgcaggcatggttccagtttccatgaatccggggcctaacatgggacagccg
caaccaggaatgacttctaatggccctctacctgacccaactatgatccgtggcagtgtg
ccaaaccagatgatgcctcggataactccacaatctggtttgaatcaatttggccagatg
agcatggcccagccccctattgtaccccggcaaacccctcctcttcagcaccatggacag
ttggctcaacctggagctctcaacccgcctatgggttatgggcctcgtatgcaacagcct
tccaaccagggccagttccttcctcagactcagttcccatcacagggaatgaatgtaaca
aatatccctttggctccgtccagcggtcaagctccagtgtctcaagcacaaatgtctagt
tcttcctgcccggtgaactctcctataatgcctccagggtctcaggggagccacattcac
tgtccccagcttcctcaaccagctctgcatcagaattcaccctcgcctgtacctagtcgt
acccccacccctcaccatactcccccaaacataggggctcagcagccaccagcaacaaca
attccagcccctgttcctacacctcctgctatgccacctgggccacagtcccaggctcta
catccccctccaaggcagacacctacaccaccaacaacacaacttccccaacaagtgcag
ccttcacttcctgctgcaccttctgctgaccagccccagcagcagcctcgctcacagcag
agcacagcagcgtctgttcctaccccaacagcaccgttgcttcctccacagcctgcaact
ccactttcccagccagctgtaagcattgaaggacaggtatcaaaccctccatctactagt
agcacagaagtgaattctcaggccattcctgagaagcagccttcccaggaagtgaagatg
gaggccaaaatggaagtggatcaaccagaaccagcagatactcagccggaggatatttca
gagtctaaagtggaagactgtaaaatggaatctaccgaaacagaagagagaagcactgag
ttaaaaactgaaataaaagaggaggaagaccagccaagtacttcagctacccagtcatct
ccggctccaggacagtcaaagaaaaagattttcaaaccagaagaactacgacaggcactg
atgccaacattggaggcactttaccgtcaggatccagaatcccttccctttcgtcaacct
gtggaccctcagcttttaggaatccctgattactttgatattgtgaagagccccatggat
ctttctaccattaagaggaagttagacactggacagtatcaggagccctggcaatatgtc
gatgatatttggctgatgttcaataatgcctggttatataaccggaaaacatcacgggta
tacaaatactgctccaagctctctgaggtctttgaacaagaaattgacccagtgatgcaa
agccttggatactgttgtggcagaaagttggagttctctccacagacactgtgttgctac
ggcaaacagttgtgcacaatacctcgtgatgccacttattacagttaccagaacaggtat
catttctgtgagaagtgtttcaatgagatccaaggggagagcgtttctttgggggatgac
ccttcccagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacaca
ctggatcctgaactgtttgttgaatgtacagagtgcggaagaaagatgcatcagatctgt
gtccttcaccatgagatcatctggcccgctggattcgtctgtgatggctgtttaaagaaa
agtgcacgaactaggaaagaaaataagttttctgctaaaaggttgccatctaccagactt
ggcacctttctagagaatcgtgtgaatgactttctgaggcgacagaatcaccctgagtca
ggagaggtcactgttagagtagttcatgcttctgacaaaaccgtggaagtaaaaccaggc
atgaaagcaaggtttgtggacagtggagagatggcagaatcctttccgtaccgaaccaaa
gccctctttgcctttgaagaaattgatggcgttgacctatgcttctttggcatgcatgtt
caagagtatggctctgactgccctccacccaaccagaggagagtatacatatcttacctc
gatagtgttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatccta
attggttatttagaatatgtcaagaaattaggttacacaacagggcatatttgggcatgt
ccaccaagtgagggagatgattatatcttccattgccatcctcctgaccagaagataccc
aagcccaagcgactgcaggaatggtacaaaaaaatgcttgacaaggctgtatcagagcgt
attgtccatgactacaaggatatttttaaacaagctactgaagatagattaacaagtgca
aaggaattgccttactttgagggtgatttctggcccaatgttctggaagaaagcattaag
gaactggaacaggaggaagaagagagaaaacgagaggaaaacaccagcaatgaaagcaca
gatgtgaccaagggagacagcaaaaatgctaaaaagaagaataataagaaaaccagcaaa
aataagagcagcctgagtaggggcaacaagaagaaacccgggatgcccaatgtatctaac
gacctctcacagaaactatatgccactatggagaagcataaagaggtcttctttgtgatc
cgcctcattgctggccctgccgccaactccctgcctcccattgttgatcctgaccctctc
attccctgcgatctgatggatggtcgggatgcctttctcacgctggcaagggacaagcac
ctggagttctcttcactccgaagagcccagtggtccaccatatgcatgctggtggagctg
cacacacagagccaggaccgctttgtctacacctgcaatgaatgcaagcaccatgtggag
acacgttggcactgtactgtctgtgaggattatgacttgtgtatcacctgctataacact
aaaaaccatgaccacaaaatggagaaactaggtcttggcttagatgatgagagcaacaac
cagcaggctgcagccacccagagcccaggcgattctcgccgcctgagtatccagcgctgc
atccagtctctggtccatgcttgccagtgtcggaatgccaattgctcactgccatcctgc
cagaagatgaagcgggttgtgcagcataccaagggttgcaaacggaaaaccaatggcggg
tgccccatctgcaagcagctcattgccctctgctgctaccatgccaagcactgccaggag
aacaaatgcccggtgccgttctgcctaaacatcaagcagaagctccggcagcaacaactg
cagcaccgattacagcaggcccaaatgcttcgcaggaggatggccagcatgcagcggact
ggtgtggttgggcagcaacagggcctcccttccccaactcctgccactccaacgacacca
actggccaacagccagccaccccgcagaccccccagcccacttctcagcctcagcctacc
cctcccaatagcatgccaccctacttgcccaggactcaagctgctggacctgtgtcccag
ggtaaggcagcaggccaggtgacccctccaacccctcctcagactgctcagccacccctt
ccagggccgccacctgcagcagtggaaatggcaatgcagattcagagagcagcagagacg
cagcgccagatggcccacgtgcaaatttttcaaaggccaatccaacaccagatgcccccg
atgactcccatggcccccatgggtatgaacccacctcccatgaccagaggtcccagtggg
catttggagccagggatgggaccgacagggatgcagcaacagccaccctggggccaagga
ggattgcctcagccccagcaactacagtctgggatgccaaggccagccatgatgtcagtg
gcccagcatggtcaacccttgaacatggctccacaaccaggattgggccaggtaggtgtg
agcccactcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctc
aggtctcccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaacccc
cagctgttggctgcattcatcaagcagcgggctgccaaatatgccaactctaattcacaa
cccatcccggggcagccagggctgcagccacctaccatgccaggtcagcagggggtccac
tccaacccagccatgcagaacatgaatccaatgcaggcgggcgtccagagggctggcctg
ccccagcagcaaccacagcagcaactccagccacccatgggagggatgagcccccaggct
cagcagatgaacatgaaccacaacaccatgccttcacaattccgagacatcttgagacga
cagcaaatgatgcaacagcagcagcaacagggagcagggccaggaataggccctggaatg
gccaaccataaccagttccagcaaccccaaggagttggctacccaccacagcagcagcag
cagcggatgcagcatcacatgcaacagatgcaacaaggaaatatgggacagatgggccag
cttccccaggccttgggagcagaggcaggtgccagtctacaggcctatcagcagcgactc
cttcagcaacaaatggggtctcctgctcagcccaaccccatgagcccccagcagcatatg
ctcccaaatcaggcccagtctccacacctacaaggccagcagatccctaattcactctcc
aatcaagtgcgctctccccagcctgtcccttctccacggccacagtcccagcccccccac
tccagcccttccccaaggatgcagcctcagccttctccacaccacgtttccccacagaca
agttccccacatcctggactggtagctgcccaggccaaccccatggaacaagggcatttt
gccagcccggaccagaattcaatgctttctcagcttgctagcaatccaggcatggcaaac
ctccatggtgcaagcgccacggacctgggactcagcaccgataactcagacttgaattca
aacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system