KEGG   Pongo abelii (Sumatran orangutan): 100455278Help
Entry
100455278         CDS       T01416                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100455278 (EIF3B)
Translation factors [BR:pon03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100455278 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 870 aa AA seqDB search
MAAVGPMQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTKASSEE
VGVAEAGPELEVRTEPATEAEAASGPSESPSPPASEEPPGSHAEPPAPTQGEAPGEQARE
SPSDSRAQAASENEGGGEGRAAEAEPRALENGDADEPSFRDPEEFVDDVSEEELLGDVLK
DRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIF
LEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLR
YWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQ
RGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHK
KRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSP
GGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTP
KGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHV
KNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMA
SDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQ
EQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNE
RLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGIRSDLERCAPGVCSGGFKAPASI
SFLFGVFCRNRRRWLRRLSNATGSTFSCAQ
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgttgggcccatgcaggacgcggagaacgtggcggtgcccgaggcggccgag
gagcgcgccgagcccggtcagcagcagccggccgccgagccgccgccagccgaggggctg
ctgcgacccgcggggcctggcgctccggaggcggcggggaccaaggcctccagtgaggag
gtgggggtcgcggaggcagggccggagcttgaggtgaggaccgagccggcgaccgaggca
gaggcggcctccggcccgtctgagtcgccctcgccgccggcctccgaggagccgcccggg
tcgcatgctgagccccctgccccgacacagggcgaggccccaggagagcaggctcgggaa
agcccatccgacagccgggcccaggcggcgtccgagaacgagggaggaggcgagggcaga
gcggccgaggccgaaccccgggctctggagaacggcgacgcggacgaaccctctttcaga
gaccccgaggaattcgtggacgacgtgagcgaggaagaattactgggagatgtactcaaa
gaccggccccaggaagcagatggaatcgattcggtgattgtagtggacaatgtccctcag
gtgggaccagaccgacttgagaaactcaaaaatgtcatccacaagatcttttccaagttt
gggaaaatcacaaatgatttttatcctgaagaggatgggaagacaaaagggtatattttc
ctggagtacgcgtctcctgcccacgctgtggatgccgtgaagaacgccgacggctataag
cttgacaagcagcacacgttccgggtcaacctcttcacggattttgacaagtatatgacc
atcagtgacgagtgggatattccagagaaacagcctttcaaagacctggggaacttacgt
tactggcttgaagaggcagaatgcagagatcagtacagtgtgatttttgagagtggagac
cgcacttccatattctggaatgacgtaaaagaccctgtctcaattgaagaaagagcgaga
tggacagagacgtatgtgcgttggtctcctaagggcacctacctggctacctttcatcaa
agaggcattgctctatgggggggagagaaattcaagcaaattcagagattcagccaccaa
ggggttcagctcattgacttctcaccttgtgaaaggtacctggtgacctttagccccctg
atggacacgcaggatgaccctcaggccataatcatctgggacatccttacggggcacaag
aagaggggttttcactgtgagagctcagcccattggcctatttttaagtggagccatgat
ggcaaattctttgccagaatgaccctggatacgcttagcatctatgaaactccttctatg
gggcttttggacaagaagagtttgaagatctccgggataaaagacttttcttggtctcct
ggtggtaacataatcgccttctgggtgcctgaagacaaagatattccagccagggtaact
ctgatgcagctccctaccaggcaagagatccgagtgagaaacctgttcaatgtggtggac
tgcaagctccattggcagaagaacggagactacttgtgtgtgaaagtagataggactccg
aaaggcacccagggtgttgtcacaaattttgaaattttccgaatgagggagaaacaggta
cctgtggatgtggtcgaaatgaaagaaaccatcatagcctttgcctgggaaccaaatgga
agtaagtttgctgtgctgcacggagaggctccacggatatctgtgtctttctaccacgtc
aaaaacaacgggaagattgaactcatcaagatgttcgacaagcagcaggcaaacaccatc
ttctggagcccccaaggacagttcgtggtgttggcgggcctgaggagtatgaacggtgcc
ttagcgtttgtggacacttcggactgcacggtcatgaacatcgcagagcactacatggct
tccgacgtcgaatgggatcctactgggcgctacgtcgtcacctctgtgtcctggtggagc
cataaggtggacaacgcgtactggctgtggactttccaggggcgcctcctgcagaagaac
aacaaagaccgcttctgccagctgctgtggcggccccggcctcccacactcctgagccag
gagcagatcaagcaaattaaaaaggatctgaagaaatactctaagatctttgaacagaag
gatcgtttgagtcagtccaaagcctcaaaggaattggtggagagaaggcgcaccatgatg
gaagatttccggaagtaccggaaaatggcccaggagctctatatggagcagaaaaacgag
cgcctggagttgcgaggaggggtggacactgacgagctggacagcaacgtggacgactgg
gaagaggagaccattgagttcttcgtcactgaagaaatcatccccctcggaatcaggagt
gacctggagcgctgtgcccctggtgtctgcagtggggggtttaaggcacccgcttccatt
tctttcttgtttggagttttctgtcggaaccgccggcgttggctccgtagacttagcaac
gccaccggcagcaccttctcctgcgcccagtga

DBGET integrated database retrieval system