KEGG   Pongo abelii (Sumatran orangutan): 100455311Help
Entry
100455311         CDS       T01416                                 

Gene name
UROS
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pon00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 265 aa AA seqDB search
MKVLLLKDAKEDDCGQDPYIRELELYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYGGLI
FTSPRAVEAAELCLEKNNKTEVWKRSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCG
NAEKLAEYICSRESSALPLLFPCGNLKREILPKALKDKGIAMESITVYQTIPHPGIQGNL
NSYYSQQGVPASITFFSPSGLTYSLKHIQELSGNNIDQIKFAAIGPTTARALAAQGLPVS
CTAESPTPQALATGIRKALQPHGCC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcttttactgaaggatgcgaaggaagacgactgtggccaggatccatatatc
agggaattagaattatatggacttgaagccactttgatccctgttttatcatttgagttt
ttgtctcttcccagtttctctgagaagctttctcatcctgaagattacgggggactcatt
tttaccagccccagagcagtggaagcagcagagttatgtttggagaaaaacaataaaact
gaagtctggaaaaggtctctgaaagaaaaatggaatgccaagtcagtgtatgtggttgga
aatgctactgcttctctagtgagtaaaattggcctggatacagaaggagaaacctgtgga
aatgcagaaaagcttgcagaatatatttgttccagggagtcctcagcactgcctcttctc
tttccctgtggaaacctcaaaagagaaatcctgccaaaagcgctcaaggacaaagggatt
gccatggaaagcataactgtgtatcagacaattccacacccaggaatccaagggaacctg
aacagctactattcccagcagggggttccagccagcatcacatttttcagtccctctggc
ctcacatacagtctcaagcacattcaggagttatctggtaacaatatcgatcaaattaag
tttgcagccatcggccccactacggctcgcgcgctggccgcccagggccttcctgtaagc
tgcactgcagagagccccacgccacaagccctggccactggcatcaggaaggctctccag
ccccatggctgctgctga

DBGET integrated database retrieval system