KEGG   Pongo abelii (Sumatran orangutan): 100455333Help
Entry
100455333         CDS       T01416                                 

Gene name
FCGR2A
Definition
Fc fragment of IgG, low affinity IIa, receptor (CD32)
Orthology
K06472  
low affinity immunoglobulin gamma Fc region receptor II-a
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Phagosome
Osteoclast differentiation
Platelet activation
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100455333 (FCGR2A)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100455333 (FCGR2A)
   04666 Fc gamma R-mediated phagocytosis
    100455333 (FCGR2A)
  Development
   04380 Osteoclast differentiation
    100455333 (FCGR2A)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    100455333 (FCGR2A)
  Infectious diseases
   05150 Staphylococcus aureus infection
    100455333 (FCGR2A)
   05152 Tuberculosis
    100455333 (FCGR2A)
   05140 Leishmaniasis
    100455333 (FCGR2A)
Cellular antigens [BR:pon04090]
 Proteins
  100455333 (FCGR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 335 aa AA seqDB search
MTMETQMSQNVCPRNLWLLQSLTVLLLLASADSQAAPPKAVLKLEPPWINVLQDDSVTLT
CRGAHSPESDSTQWFHNGNLILTHTQPSYRFKANNNDSGEYRCQTGQTSLSDPVHLTVLS
EWLVLQTPHLEFQEGETIVLRCHSWKDKPLAKVTFFQNGKSKKFSYSDPNFSIPQANHSH
GGDYHCTGNIGHTLFSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKK
RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIY
LTLPPNDHVNMQLPEGCDLLREVIPGRLEHDRQSP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactatggagacccaaatgtctcagaatgtatgtcccagaaacctgtggctgcttcaa
tcattgacagttttgctgctgctggcttctgcagacagtcaagctgctcccccaaaggct
gtgctgaaactcgagcccccgtggatcaacgtgctccaggacgactctgtgactctgaca
tgccggggggctcacagccctgagagcgactccactcagtggttccacaatgggaatctc
atcctcacccacacgcagcccagctacaggttcaaggccaacaacaatgacagtggggag
tacaggtgccagactggccagaccagcctcagcgaccctgtgcatcttactgtgctttcc
gagtggctggtgctccagacccctcacctggagttccaagagggagaaaccatcgtgctg
aggtgccacagctggaaggacaagcctctggccaaggtcacattcttccagaatggaaaa
tccaagaaattttcctattcggatcccaacttctccatcccacaagcaaaccacagtcac
ggtggtgattaccactgcacaggaaacataggccacacgctgttctcatctaagcctgtg
accatcactgtccaagcgcccagctcttcaccaatggggatcattgtggctgtggtcact
gggattgctgtagcggccattgttgctgctgtagtggccttgatctactgcaggaaaaag
aggatttcagccaattccactgatcctgtgaaggctgcccaatttgagccacctggacgt
caaatgattgccatcagaaagagacaacttgaagaaaccaacaatgactatgaaacagct
gatggcggctacatgactctcaaccccagggcacctactgacgatgataaaaacatctac
ctgactcttcctcccaatgaccatgtcaacatgcagttaccagaaggatgtgaccttctc
agagaagtcattccaggcagattagaacatgaccgacagtctccttga

  All links  
No link information was found.   
DBGET integrated database retrieval system