KEGG   Pongo abelii (Sumatran orangutan): 100455504Help
Entry
100455504         CDS       T01416                                 

Gene name
ACSS2
Definition
acyl-CoA synthetase short-chain family member 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pon01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pon00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pon00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pon00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 731 aa AA seqDB search
MGLPEERGRSGSGSRGQEEAGAGGRARSWSPPPEVSRSAHVPSLQRYRELHRRSVEEPRE
FWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDK
VAFYWSTSGNSSYRYACKEGNEPGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYM
PMIPELVVAMLACARIGALHSIVVGVWAGEKGQAWGVGLWRSLECLLLPKDAFYRGEKLV
NLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSPSQSPPIKRSCPDVQGKLKEK
SKRVQPQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVG
GYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDV
NRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYH
RVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSATFPFFGVAPAILNESGEELEGE
AEGYLVFKQPWPGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDM
LNVSGHLLSTAEVESALVEHESVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPKLTEEL
KKQIREKIGPIATPDYIQNAPGLPKISLVYREYVQRPPWIGMGFFVFRMMNFWFGQSQGG
FTDRAFDKPLS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggggcttcctgaggagcggggccggagcggcagcgggagccggggccaggaggaagct
ggagccggaggccgggcgcggagttggtctccgccgcccgaggtcagccgctccgcgcac
gtcccctcgctgcagcgctaccgcgagctgcaccggcgctccgtggaggagccgcgggaa
ttctggggagacattgccaaggaattttactggaagactccatgccctggcccattcctt
cggtacaactttgatgtgactaaagggaaaatcttcattgagtggatgaaaggagcaact
accaacatctgctacaatgtactggatcgaaatgtccatgagaaaaagcttggagataaa
gttgctttttactggtccacttctggtaattcatcctacagatatgcttgcaaggagggc
aatgagccaggggagaccactcagatcacataccatcagcttctggtccaagtgtgtcag
ttcagcaatgttctccgaaaacagggcattcagaagggggaccgagtggccatctacatg
cctatgatcccagagcttgtggtggccatgctggcatgtgcccgcattggggctttgcac
tccattgtggtaggagtttgggctggtgaaaaggggcaggcctggggggtggggctctgg
agaagcctggaatgtctgttgctccccaaagatgccttctacaggggggaaaagcttgtg
aacctgaaggagctggctgacgaggccctgcagaagtgccaggagaagggtttcccagta
agatgctgcattgtggtcaagcacctggggcgggcagagctgggcatgggtgactccccc
agccagtcccccccaattaagaggtcatgcccggatgtgcagggtaagctgaaagagaaa
tccaagcgtgttcagccccagatctcatggaaccaagggattgacttgtggtggcatgag
ctcatgcaagaggcaggggatgagtgtgagcccgagtggtgtgatgccgaggacccactc
ttcatactgtacaccagtggctccacaggcaaacccaagggtgtggttcacacagttggg
ggctacatgctctatgtagccacaaccttcaagtatgtgtttgacttccatgcggaggat
gtgttctggtgcacggcagacattggttggatcactggtcattcctacgtcacctatggg
ccactggccaatggtgccaccagtgttttgtttgaggggattcccacatatccggacgtg
aaccgcctatggagcattgtggacaaatacaaggtgaccaagttctacacagcacccaca
gccatccgtctgctcatgaagtttggagatgagcctgtcaccaagcatagccgggcatcc
ttgcaggtgttaggcacagtgggtgaacccatcaaccctgaggcctggctatggtaccac
cgagtggtaggtgcccagcgctgccccatcgtggacaccttctggcaaacagagacaggt
ggccacatgttgactccccttcctggtgccacacccatgaaacctggttctgctactttc
ccattctttggtgtagctcctgcaatcctgaatgagtccggggaagagttggaaggtgaa
gctgaaggttatctggtgttcaagcagccctggccagggatcatgcgcacagtctatggg
aaccacgaacgctttgagacaacctactttaagaagtttcctggatactatgttacagga
gatggctgccagagggaccaggatggctattactggatcactggcaggattgatgacatg
ctcaatgtatctggacacctgctgagtacagcggaggtggagtcagcacttgtggaacat
gagtctgttgcagaggcagctgtggtgggccaccctcatcctgtgaagggtgaatgcctc
tactgctttgtcaccttgtgtgatggccacaccttcagccccaagctcaccgaggagctc
aagaagcagattagagaaaagattggccccattgccacaccagactacatccagaatgca
cctggcttgcctaaaatctctcttgtttacagggagtatgttcagaggcctccatggatt
gggatgggcttttttgtattccgtatgatgaacttttggtttgggcagagccaaggaggc
ttcactgacagggcttttgacaagcccctgagctaa

DBGET integrated database retrieval system