KEGG   Pongo abelii (Sumatran orangutan): 100455657Help
Entry
100455657         CDS       T01416                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
pon04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100455657 (MGAM2)
   00500 Starch and sucrose metabolism
    100455657 (MGAM2)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100455657 (MGAM2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100455657 (MGAM2)
    3.2.1.20  alpha-glucosidase
     100455657 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100455657
NCBI-ProteinID: XP_024105743
Position
7
AA seq 2516 aa AA seqDB search
MARKLSVLEVLLIIFCLIVVTIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQEV
TEDICRWQYKCCWSPVVDANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENINLVDGTADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQYAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDASGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYN
NGSLKRVWILGNNGFAVGEGYPGPTVFPDYTNPVCTEWWTDQVAKFHDHLEFDGVWIEMN
EVSSLLQASDNQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHGGLHYDIHSLYGHSMA
RTTNLALETIFMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYNNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGADSLLLNSSRH
YLNIRYTLLPYLYTLFYRAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAIPWRKQLVNMLLPGDKIGLHLRGGYIFPTQKPNTTTE
TSRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNY
MDTDNLMFTDMTILGMDKQPANFIVLVNNVTTSSPSIVYSASTKVVTITDLQGLVLGQEF
SITWHLPVSDLEKFNCYPDNSTASKESCRQRGCLWEDTSTPGVPTCYYDTIPNYVASDIQ
YLNTSITADLSLLMAPESAAAAASDSLSAKISFLHLNVIYHTATMLQVKIYDPTNKRYEV
PVPLNTPPQPVGDPENRLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFTFNDMFLSIST
RLPSQYIYGFGETEHTTFRRNMNWNTWGMFSRDEPPTYKKNAYGVHPYYMALEEDGSAHG
VLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWAL
GFQLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSVLIEQ
MKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTNDIVWGKVWPDLPNVIVDG
SLDHETQVKLYRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEPS
NFVDGSVRGCSDEMLNNPPYMPYLESRDKGLNSKTLCMESQQILPDSSSVQHYNVHSLYG
WSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTAEWDQLGKSIIGMMDFSL
FGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMLSR
EVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDRQFMLGPAILISPVL
ETSTFEVSAYFPRARWYDYSTGTGSKSTGQRKILKAPLDHINLHVRGGYILPWQEPAMNT
HSSRQNFMGLIIALDDNGTAEGQVFWDDGQSIDTYENGNYFLANFIAAQNFLQIQTIHNK
YLSDSNPLKVGYIRIWGVNTYVTQVSYTYDNQQFMETNFKSDPYNQILNIQLTDKTVNLE
KLTEVTWIDGGPVLPTPTETSTIPMSSHPSPSTTNATSSETITSSASANTTTGTTATVPI
TTTSFPSTTNVTTNTTVTDTTSPFPTSTTNASTNATVPITTTRFATSTIGVTTNATVPDT
TAPFPTNTTTASTNATIPITTTPFATSTIGVTTSTTIPDTTAPFPTSTTSASTNATPVPI
TTTLFATSTIGVTTGTTVPDTTAPFPTSTTSASTNATPVPITATLFATSTIGVTTGTTVP
DTTAPFPTSTTGASTSATVPITTTSSLTNTADANTSNSVPNTTMPSPTSSTTVRTIATVP
MSVTPSLTSTADATISTTVLIATTSSLTGTTDVSTSTTINNISTPVQTNTTNASTSTNVA
NITATSHTSTDDTVPNNTVPITAIPSLANTGVDTTSNSFSIMTTSLSESTNAMNTAVIMA
TTSPTSTDVASTNNDASMTNFLLATMSAGNTTSNSISITTTSFGNSVPIVTAPSPNTGAT
TTSNNTIPGMTTYYQTSPTIPTHTLTSIPSSSTPILSMFPTSNTFTTDKITNFTTPTNAN
TIIFNTLDTKSTMIIDATVTTTSTKDNTMSPDTTVTSIDKFTTHITQFTTPHSATSATLA
LSHTSLAPTNLSDLGTIDITDADNSSSVTGNTTHFSVSNVTTASDTITATGLDSQTLHMV
TNSAATYLPITATSATTDTTNITKYALNTTTPDSTVHTSATAPAYITNAINTTQVP
NT seq 7551 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcagtgtattggaagtccttctgatcatcttctgcttaattgtggtg
accatagatatcctcttgctgcttcttgtgttggaggaaacttcagatacttcatttact
ccagagtgcccagagattccccaatcggaaaggatagactgcacacctgaccaggaggtg
accgaggatatctgcagatggcaatataagtgctgctggtcacctgtggtggatgccaat
gtccctaggtgcttcttcccctggaactggggctatgaagccagcaatggccatacaaat
acaagcacaggatttactgcccagttgaaaaggttgccatcaccatctctgtttggaaat
gatgttgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatacgctatgaagtttcccatgaaaatattaacctggttgat
gggactgctgatgcctccaatttgagctattacgtggaggttactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcctgttggacacgagcatcgggcccctc
cagtatgcccagcagtacctgcaactgtctttccgactgcccagtgccaatgtgtatggg
ctgggagagcatgtgcaccagcagtaccgccacaatatgacctggaagacctggcccatc
ttcacccgggatgctacccccaccgagggcatgattaatctgtatggagctcataccttc
ttcttgtgccttgaagatgccagtggctcctcttttggagtttttctgatgaacagtaat
gccatggaggttacccttcagccagctcctgcaatcacttatcgcacaattggaggcatt
cttgacttttatgtattcctaggaaacactccagaacaagtggttcaggaatacttggag
cttgttggacggccattcttgcctccctattggagtcttgggttccagcttagtcgcagg
gattatggtggcatcaataaattgaaagaagttgtaagccgaaatcgtttagctgagata
ccatatgatgtccagtactctgacatagactacatggatggaaagaaggatttcactgtt
gatgaagtcgcttactctggtctcccagattttgtcaaggagttacatgacaatgggcag
aaatatcttattattatgaatcctggcatctccaaaaactctaactatgagccctataat
aatggaagcctaaagagagtgtggatcttggggaacaatggctttgctgttggggaggga
tatccgggaccgacagtctttcccgattataccaacccagtatgcactgagtggtggaca
gatcaggttgctaaatttcatgatcatctggagtttgatggagtgtggattgaaatgaat
gaagtgtctagcttactccaagcttctgataaccagtgtgaatccaacaacttgaacttt
cctccttttcttcctagagttctggatcacttactttttgcaagaactctctgcatggac
acggagtttcatgggggccttcactatgacatccacagcttgtatggccactccatggca
agaaccacaaacttagccctggagaccatcttcatgaataataggagcttcatcttatcc
cgttctacttttgctggatctggcaaatttgctgctcattggctgggggacaatgcagcc
acatgggatgacctccgatggtctatccccactatccttgagttcaacctgtttggcatc
cccatggtaggtgccaacatctgtggttataacaacaatgtcacagaggagctctgcaga
aggtggatgcagcttggagcattttatccactaccaaggaatcacaatgggcccgggttc
agggaccaggatcctgctgcctttggtgccgattccctgctgctgaattcctccagacat
tatctgaacatccgctacaccttgctgccctatctctatacccttttctaccgcgctcac
acccggggagagacggtagcaaggccccttgtacatgagttctaccaggactcagccacg
tgggatgtgcatgagcagttcttatggggacctggactcctcatcacgcctgttttatat
gaaggtgtggatgaagtgaaagcatacatacctgatgccacctggtatgactatgagaca
ggagtggccatcccatggaggaaacagttggtgaatatgcttctcccaggtgataagata
ggacttcatctgcgagggggctacatatttcccactcagaagccaaacacaaccacagaa
accagccggaggaattccctgggactcatcatcgctttggactataagagagaagcaaag
ggggagctgtactgggatgacggtgtatctaaagatgctgtgactgaaaagaagtatatt
ctatatgatttctctgttacctctaaccatctacaagcaaagattataaataataattat
atggacactgacaacctcatgtttacagatatgacaatcttgggaatggacaaacagcca
gctaattttatcgtcttagtgaataatgtcaccacctccagtccaagcattgtttacagt
gcttccacaaaggtggtaaccatcactgatctccaaggactggtactgggacaagaattc
tctattacgtggcatcttcctgtcagtgacctggagaagttcaactgctaccctgacaat
tcaacagcctctaaggagagttgtaggcagcgggggtgtctttgggaggacacatctact
cctggagtgcccacctgttactatgacaccatccctaattatgttgctagtgacattcag
tacctgaacaccagcatcactgcagacctttccctcctgatggcccctgagtcagctgct
gctgctgcctctgattctctctctgcaaagatcagcttcctccacctgaacgtgatctat
cacacagcaaccatgctgcaggtcaagatctatgaccccactaataaaagatatgaggtt
ccagtaccactaaacacccctccccaaccagttggtgaccctgaaaaccgtctgtatgat
gtcaggattcaaaacaatccttttggaatccagattcaacgcaaaaactccagcactgtg
atttgggattctcagctccctggcttcaccttcaatgacatgtttctctccatttctacg
cgtcttccgtctcagtacatctatggctttggggaaactgagcacacgactttcagaaga
aacatgaactggaacacatggggaatgttttctcgtgatgagccacctacgtacaagaag
aatgcctatggtgtccacccttactacatggcactggaggaggatggcagcgcccatgga
gtgctcctgctaaatagcaatgccatggatgtgacattacagcccactcctgccctgaca
taccgcaccacaggagggattttggacttctacattgttttggggccaacccctgaactt
gtaactcagcaatacacagagttgattggtcggccagcaatgattccatactgggccttg
ggattccagctgagtcgctatggataccagaatgatgctgaaatctccagtttgtatgat
gcaatggtggcagcccagattccctatgacgtccagcatgtagacatcgattacatgaac
cggaagctggatttcaccctcagtgccaactttcaaaacctcagtgttctgattgagcaa
atgaagaaaaatggcatgagatttattctcattttggacccagccatttctggcaatgag
acacagtatctcccattcattagaggacaggaaaataacgtgttcatcaaatggcctgac
accaatgacattgtctggggaaaggtttggccagatctgcctaatgtaattgtagatgga
tcccttgaccatgaaactcaggttaagctttacagggcctacgttgcctttcctgacttc
tttcgtaatagcacagctgcgtggtggaagaaagagatagaagagctctatgcaaaccct
cgagagccagagaagagcttgaagtttgatggattgtggattgatatgaatgagccatca
aattttgtggatggatctgtcaggggctgcagcgatgaaatgctaaataacccaccctat
atgccatatttggaatccagggacaagggcctgaacagcaagaccctgtgcatggagagt
cagcagatcctgccagacagctcctccgtgcagcactacaatgttcacagcctgtacggg
tggtcccagaccagacccacatacgaagctgtgcaggaggtgacaggacagcgaggggtc
gtcatcacccgctccacatttccctcttctggacgctggggaggacactggctgggagac
aacacagctgagtgggaccagctggggaaatctatcattggcatgatggatttcagtctc
tttggaataccttatacaggagcagatatctgtgggttctttggagatgctgaatatgag
atgtgtgttcgctggatgcaactgggggcattttatccattttccagaaaccacaacaac
atcgggacaaggagacaagatcctgtggcctggaattcaacctttgagatgttgtccaga
gaagtcctagagaccagatacaccctgcttccttatctctatactctgatgcataaagct
cacgttgagggcagcactgttgtccggccccttctccatgagtttacggatgacaggaca
acatgggatatagaccgtcagttcatgttgggccctgctatcttaatcagccctgtgttg
gaaactagcacatttgaggtctctgcttattttccaagagcccgttggtatgactatagc
acgggaactggcagcaaatcgacaggtcagaggaaaatcctgaaggctccccttgaccac
atcaaccttcatgtcagaggaggctacatcctgccctggcaagagcctgcaatgaacact
cactccagtcgacaaaattttatgggattgattattgctttggatgacaatgggacagct
gaaggccaggtgttctgggatgatggacaaagcattgatacctatgaaaatggaaattat
tttttggcaaactttatagcagctcagaacttcctgcaaatccagaccatacacaataag
tatttgagtgactcgaatccactaaaagttgggtatattagaatctggggtgtgaatacc
tatgtgacacaagtcagttacacctatgacaatcagcaatttatggagacaaatttcaag
agtgacccttataatcagatactaaatattcaattgactgacaagactgtcaacctggaa
aagttaactgaggttacttggattgatggtggtcctgtacttcctactccaactgagaca
agtaccatcccaatgagttctcatccttctccatctactaccaatgccaccagttctgag
acaatcaccagttctgccagtgcaaatactaccactggcactactgctactgttcctatc
acaaccacatctttcccaagtactactaatgttacaactaatactactgttactgataca
acttctcctttccctacaagtactactaatgctagcactaatgctactgttcctatcaca
accacacgttttgcaacaagtactattggtgttacaactaatgctactgttcccgataca
actgcccctttcccaacgaatactactactgctagcactaatgctactattcctatcaca
accacaccttttgcaacaagtactattggtgttacaactagtactactattcctgataca
actgctcctttccctacaagtactactagtgctagcactaatgctacccctgttcctatc
acaaccacactttttgcaacaagtactattggtgttacaactggtactactgttcctgat
acaactgctcctttccctacaagtactactagtgctagcactaatgctacccctgttcct
atcacagccacactttttgcaacaagtactattggtgttacaactggtactactgttcct
gatacaactgctcctttccctacaagtactactggtgctagcactagtgctactgttcct
attacaaccacatcttcccttacaaatactgctgatgctaacactagtaatagtgttcct
aataccactatgccttctcctacaagtagtactactgtgcgtactattgctaccgttccc
atgtcagtgactccttctctgacaagtactgctgatgccaccattagcactactgtactt
attgccactacttcttctctaacaggtactactgatgttagcactagtactactattaat
aatataagtactcctgttcaaacaaatactactaatgctagtactagtactaatgttgct
aatataactgctacctctcatacaagtactgatgatactgttcctaataatactgttcca
attacagctattccttctcttgcaaatactggtgttgacactactagcaacagtttttcc
attatgaccacttctctctctgaaagtactaatgctatgaacactgctgttattatggca
actacttctcctacaagtactgatgttgctagcacaaataatgatgcttctatgacaaat
tttcttttagctacaatgtctgctggtaatacaactagtaatagtatttccataacaact
acttcttttggtaatagtgttcctattgtgactgctccttctccaaatactggtgctact
actacaagtaataatactattcctggcatgactacttattaccagacttctcctaccatt
cctacccatactcttacttctattcctagctctagtactcctattttgagcatgtttcca
acaagtaatacattcactactgataaaattactaattttactacccctacaaatgcaaac
accattattttcaacactcttgatacaaaaagtaccatgataatagatgctacggtcact
actaccagcaccaaagataataccatgagtccagatacaacagttacttccatagacaaa
ttcaccacacacatcacacagttcactactccccattctgctactagtgcaacactggcc
ttaagccacacctcattagctcctacaaatctttcggatctaggcaccatagatattact
gatgcagataactccagcagtgttacaggtaacactacacacttttctgtttcaaatgtc
acaacagcctcagacacaataacagctactggtctagattcacaaactctccatatggta
acaaattctgcggctacttatttacctattactgcaactagtgctaccacagatactaca
aatattacaaaatatgctttgaatactaccactcctgatagtacagtacatacttctgct
actgcacctgcttatattacaaatgccataaatactactcaagttccatga

DBGET integrated database retrieval system