KEGG   Pongo abelii (Sumatran orangutan): 100455657Help
Entry
100455657         CDS       T01416                                 

Definition
probable maltase-glucoamylase-like protein
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100455657
   00500 Starch and sucrose metabolism
    100455657
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100455657
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100455657
    3.2.1.20  alpha-glucosidase
     100455657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1911 aa AA seqDB search
IHSPPHTPLAVFLSRALETIFMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIP
TILEFNLFGIPMVGANICGYNNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGA
DSLLLNSSRHYLNIRYTLLPYLYTLFYHAHTRGETVARPLVHEFYQDSATWDVHEQFLWG
PGLLITPVLYEGVDEVKAYIPDATWYDYETGVAIPWRKQLVNMLLPGDKIGLHLRGGYIF
PTQKPNTTTETSRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNH
LQAKIINNNYMDTDNLMFTDMTILGMDKQPANFIVLVNNVITSSPSIVYSASTKVVTITD
LQGLVLGQEFSITWHLPVSDLEKFNCYPDNSTASKESCRQRGCLWEDTSTPGVPTCYYDT
IPNYVASDIQYLNTGITADLSLLMAPESAAAAASDSLSAKISFLHLNVIYHTATMLQVKI
YDPTNKRYEVPVPLNTPPQPVGDPENHLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFT
FNDMFLSISTRLPSQYIYGFGETEHTTFRRNMNWNTWGMFSRDEPPTYKKNAYGVHPYYM
ALEEDGSAHGVLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIG
RPAMIPYWALGFQLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSAN
FQNLSVLIEQMKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTNDIVWGKVW
PDLPNVTVDGSLDHETQVKLYRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFD
GLWIDMNEPSNFVDGSVRGCSDEMLNNPPYMPYLESRDKGLNSKTLCMESQQILPDSSSV
QHYNVHSLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTAEWDQLGK
SIIGMMDFSLFGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVA
WNSSFEMLSREVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDRQFML
GPAILISPVLETSTFEVSAYFPRARWYDYSTGTGSKSTGQRKILKAPLDHINLHVRGGYI
LPWQEPAMNTHSSMNSNXXXXQILWDDIALDDNGTAEGQVFWDDGQSIDTYENGNYFLAN
FIAAQNFLQIQTIHNKYLSDSNPLKVGYIRIWGVNTYVTQVSYTYDNQQFMETNFKSDPY
NQILNIQLTDKTVNLEKLTEVTWIDGGPVLPTPTETSTIPMSSHPSPSTTNATSSETITS
SASANTTTGTTATVPITTTSFPSTTSVTTNTTVTDTTSPFPTSTTNASTNATVPITTTRF
ATSTIGVTTNATVPDTTAPFPTNTTTASTNATIPITTTPFATSTIGVTTSTTIPDTTAPF
PTSTTSASTNATPVPITTTSSLTNTADANTSNSVPNTTMPSPTSSTTVRTIATVPMSVTP
SLTSTADATISTTVLIATTSSLTGTTDVSTSTTINNISTPVQTNTTNASTSTNVANITAT
SHTSTDDTVPNNTVPITAIPSLANTGVDTTSNSFSIMTTSLSESTNAMNTAVIMATTSPT
STDVASTNNDASMTNFLLATMSAGNTTSNSISITTTSFGNSVPIVTAPSPNTGATTTSNN
TIPGMTTYYQTSPTIPTHTLTSIPSSSTPILSMFPTSNTFTTDKITNFTTPTNANTIIFN
TLDTKSTMIIDATVTTTSTKDNTMSPDTTVTSIDKFTTHITQFTTPHSATSATLALSHTS
LAPTNLSDLGTIDITDADNSSSVTGNTTHFSVSNVTTASDTITATGLDSQTLHMVTNSAA
TYLPITATSATTDTTNITKYALNTTTPDSTVHTSATAPAYITNAINTTQVP
NT seq 5738 nt NT seq  +upstreamnt  +downstreamnt
acattcacagcccacctcacactccactggctgtattcctttccagagccctggagacca
tcttcatgaataataggagcttcatcttatcccgttctacttttgctggatctggcaaat
ttgctgctcattggctgggggacaatgcagccacatgggatgacctccgatggtctatcc
ccactatccttgagttcaacctgtttggcatccccatggtaggtgccaacatctgtggtt
ataacaacaatgtcacagaggagctctgcagaaggtggatgcagcttggagcattttatc
cactaccaaggaatcacaatgggcccgggttcagggaccaggatcctgctgcctttggtg
ccgattccctgctgctgaattcctccagacattatctgaacatccgctacaccttgctgc
cctatctctatacccttttctaccatgctcacacccggggagagacggtagcaaggcccc
ttgtacatgagttctaccaggactcagccacgtgggatgtgcatgagcagttcttatggg
gacctggactcctcatcacgcctgttttatatgaaggtgtggatgaagtgaaagcataca
tacctgatgccacctggtatgactatgagacaggagtggccatcccatggaggaaacagt
tggtgaatatgcttctcccaggtgataagataggacttcatctgcgagggggctacatat
ttcccactcagaagccaaacacaaccacagaaaccagccggaggaattccctgggactca
tcatcgctttggactataagagagaagcaaagggggagctgtactgggatgacggtgtat
ctaaagatgctgtgactgaaaagaagtatattctatatgatttctctgttacctctaacc
atctacaagcaaagattataaataataattatatggacactgacaacctcatgtttacag
atatgacaatcttgggaatggacaaacagccagctaattttatcgtcttagtgaataatg
tcatcacctccagtccaagcattgtttacagtgcttccacaaaggtggtaaccatcactg
atctccaaggactggtactgggacaagaattctctattacgtggcatcttcctgtcagtg
acctggagaagttcaactgctaccctgacaattcaacagcctctaaggagagttgtaggc
agcgggggtgtctttgggaggacacatctactcctggagtgcccacctgttactatgaca
ccatccctaattatgttgctagtgacattcagtacctgaacaccggcatcactgcagacc
tttccctcctgatggcccctgagtcagctgctgctgctgcctctgattctctctctgcaa
agatcagcttcctccacctgaacgtgatctatcacacagcaaccatgctgcaggtcaaga
tctatgaccccactaataaaagatatgaggttccagtaccactaaacacccctccccaac
cagttggtgaccctgaaaaccatctgtatgatgtcaggattcaaaacaatccttttggaa
tccagattcaacgcaaaaactccagcactgtgatttgggattctcagctccctggcttca
ccttcaatgacatgtttctctccatttctacgcgtcttccgtctcagtatatctatggct
ttggggaaactgagcacacgactttcagaagaaacatgaactggaacacatggggaatgt
tttctcgtgatgagccacctacgtacaagaagaatgcctatggtgtccacccttactaca
tggcactggaggaggatggcagcgcccatggagtgctcctgctaaatagcaatgccatgg
atgtgacattacagcccactcctgccctgacataccgcaccacaggagggattttggact
tctacattgttttggggccaacccctgaacttgtaactcagcaatacacagagttgattg
gtcggccagcaatgattccatactgggccttgggattccagctgagtcgctatggatacc
agaatgatgctgaaatctccagtttgtatgatgcaatggtggcagcccagattccctatg
acgtccagcatgtagacatcgattacatgaaccggaagctggatttcaccctcagtgcca
actttcaaaacctcagtgttctgattgagcaaatgaagaaaaatggcatgagatttattc
tcattttggacccagccatttctggcaatgagacacagtatctcccattcattagaggac
aggaaaataacgtgttcatcaaatggcctgacaccaatgacattgtctggggaaaggttt
ggccagatctgcctaatgtaactgtagatggatcccttgaccatgaaactcaggttaagc
tttacagggcctacgttgcctttcctgacttctttcgtaatagcacagctgcgtggtgga
agaaagagatagaagagctctatgcaaaccctcgagagccagagaagagcttgaagtttg
atggattgtggattgatatgaatgagccatcaaattttgtggatggatctgtcaggggct
gcagcgatgaaatgctaaataacccaccctatatgccatatttggaatctagggacaagg
gcctgaacagcaagaccctgtgcatggagagtcagcagatcctgccagacagctcctccg
tgcagcactacaatgttcacagcctgtacgggtggtcccagaccagacccacatacgaag
ctgtgcaggaggtgacaggacagcgaggggtcgtcatcacccgctccacatttccctctt
ctggacgctggggaggacactggctgggagacaacacagctgagtgggaccagctgggga
aatctatcattggcatgatggatttcagtctctttggaataccttatacaggagcagata
tctgtgggttctttggagatgctgaatatgagatgtgtgttcgctggatgcaactggggg
cattttatccattttccagaaaccacaacaacatcgggacaaggagacaagatcctgtgg
cctggaattcaagctttgagatgttgtccagagaagtcctagagaccagatacaccctgc
ttccttatctctatactctgatgcataaagctcacgttgagggcagcactgttgtccggc
cccttctccatgagtttacggatgacaggacaacatgggatatagaccgtcagttcatgt
tgggccctgctatcttaatcagccctgtgttggaaactagcacatttgaggtctctgctt
attttccgagagcccgttggtatgactatagcacgggaactggcagcaaatcgacaggtc
agaggaaaatcctgaaggctccccttgaccacatcaaccttcatgtcagaggaggctaca
tcctgccctggcaagagcctgcaatgaacactcactccagtatgaattccaacttnnnnn
nnnnncaaattttatgggatgatattgctttggatgacaatgggacagctgaaggccagg
tgttctgggatgatggacaaagcattgatacctatgaaaatggaaattattttttggcaa
actttatagcagctcagaacttcctgcaaatccagaccatacacaataagtatttgagtg
actcgaatccactaaaagttgggtatattagaatctggggtgtgaatacctatgtgacac
aagtcagttacacctatgacaatcagcaatttatggagacaaatttcaagagtgaccctt
ataatcagatactaaatattcaattgactgacaagactgtcaacctggaaaagttaactg
aggttacttggattgatggtggtcctgtacttcctactccaactgagacaagtaccatcc
caatgagttctcatccttctccatctactaccaatgccaccagttctgagacaatcacca
gttctgccagtgcaaatactaccactggcactactgctactgttcctatcacaaccacat
ctttcccaagtactactagtgttacaactaatactactgttactgatacaacttctcctt
tccctacaagtactactaatgctagcactaatgctactgttcctatcacaaccacacgtt
ttgcaacaagtactattggtgttacaactaatgctactgttcccgatacaactgcccctt
tcccaacgaatactactactgctagcactaatgctactattcctatcacaaccacacctt
ttgcaacaagtactattggtgttacaactagtactactattcctgatacaactgctcctt
tccctacaagtactactagtgctagcactaatgctacccctgttcctatcacaaccacat
cttcccttacaaatactgctgatgctaacactagtaatagtgttcctaataccactatgc
cttctcctacaagtagtactactgtgcgtactattgctaccgttcccatgtcagtgactc
cttctctgacaagtactgctgatgccaccattagcactactgtacttattgccactactt
cttctctaacaggtactactgatgttagcactagtactactattaataatataagtactc
ctgttcaaacaaatactactaatgctagtactagtactaatgttgctaatataactgcta
cctctcatacaagtactgatgatactgttcctaataatactgttccaattacagctattc
cttctcttgcaaatactggtgttgacactactagcaacagtttttccattatgaccactt
ctctctctgaaagtactaatgctatgaacactgctgttattatggcaactacttctccta
caagtactgatgttgctagcacaaataatgatgcttctatgacaaattttcttttagcta
caatgtctgctggtaatacaactagtaatagtatttccataacaactacttcttttggta
atagtgttcctattgtgactgctccttctccaaatactggtgctactactacaagtaata
atactattcctggcatgactacttattaccagacttctcctaccattcctacccatactc
ttacttctattcctagctctagtactcctattttgagcatgtttccaacaagtaatacat
tcactactgataaaattactaattttactacccctacaaatgcaaacaccattattttca
acactcttgatacaaaaagtaccatgataatagatgctacggtcactactaccagcacca
aagataataccatgagtccagatacaacagttacttccatagacaaattcaccacacaca
tcacacagttcactactccccattctgctactagtgcaacactggccttaagccacacct
cattagctcctacaaatctttcggatctaggcaccatagatattactgatgcagataact
ccagcagtgttacaggtaacactacacacttttctgtttcaaatgtcacaacagcctcag
acacaataacagctactggtctagattcacaaactctccatatggtaacaaattctgcgg
ctacttatttacctattactgcaactagtgctaccacagatactacaaatattacaaaat
atgctttgaatactaccactcctgatagtacagtacatacttctgctactgcaccggctt
atattacaaatgccataaatactactcaagttccatga

DBGET integrated database retrieval system