KEGG   Pongo abelii (Sumatran orangutan): 100455926Help
Entry
100455926         CDS       T01416                                 

Gene name
KAT6B
Definition
(RefSeq) histone acetyltransferase KAT6B isoform X1
  KO
K11306  histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100455926 (KAT6B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100455926 (KAT6B)
   HAT complexes
    MOZ/MORF complex
     100455926 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS PHD Linker_histone Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 100455926
NCBI-ProteinID: XP_002820847
Position
10
AA seq 2077 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLPPPTPISGQSPSSQKSSTATSSPSPQSSSSQCSMPSLSSLTTNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTELSSTAKSKAHFFGKRDIRSRFISH
SSSSSWGMARGSIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILSHMEKLKTCSRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSTRANSRQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEEEEEEDEEEE
EEEEEEEEEDEEEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRG
RKRRRINSSVTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQ
HQPGKKRQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKR
GLSKWRQNKERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKET
GEALLPQEENRREETCAPVSPNTSPGEKPEDDLIKPEEEEEEEEEEEEEEEGEEEEEEGG
NVEKDPDGAKSQEKEEPEISTEKEDSARLDDHEEEEEEDEEPSHNEDHDADDEDDSHMES
AEVEKEELPRESFKEVLENQEAFLDLNVQPGHSNPEVLMDCGVDLTASCNSEPKELAGDP
EAVPESDEEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSLTQESSEQD
DTFQDCAETQEACRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPGQSVRSVNS
PSVPALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIEST
TENYENPSSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQ
QTSISSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETGNANIGLYE
RMGQSDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNT
GLVQLSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQ
IASKGHVSMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPA
YNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQ
PMQTPPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6234 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcggtcagtacttcccat
gggttggataagaagacagtctctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcaaccaaggggtctagaggatcatgtaat
gatctccgcaatgtggattggaataaacttttaaggagagcaattgaaggacttgaggag
ccaaatggctcctccctgaagaacatagagaagtatctcagaagtcaaagtgatctcaca
agcaccaccaacaacccagcctttcagcagcggctgcgactgggggccaaacgcgctgtg
aataatgggaggttactgaaagatggaccgcagtacagggtcaattatgggagcttagat
ggcaaaggggcacctcagtatcccagtgcattcccgtcctcgctcccacctgtcagcctt
ctaccccatgagaaagaccagccccgtgctgatcccattccaatatgtagcttctgtttg
gggactaaagaatcaaatcgtgaaaagaaaccagaagaactcctctcttgtgcggattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattgacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacatgcagtgcctgtagagtccaaggcaga
aatgctgataatatgcttttttgtgattcctgtgatagaggatttcatatggaatgctgt
gacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttccacccccaacccccatc
tctggtcagagccccagttcacaaaagtccagcacggccacttcttctccctctccccag
agttcttccagccagtgcagtatgccctccctgagcagccttaccactaacagccagctg
aaggcactctttgatgggctttctcatatctataccactcagggacagtctcgcaaaaag
ggacacccgagttatgcaccacccaaacgtatgcgtcgtaaaactgaattatcttccacg
gcaaaatctaaagcccacttctttggcaaaagagatattagaagtcggtttatttctcac
tcctcctcctctagctgggggatggctagaggaagtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcagattaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatactgaaataaaaataaacatcaaacaagaaagtgcagatgtaaat
gtgattggaaacaaggatgtcgttactgaagaggatttggatgtttttaagcaggcccag
gaactttcttgggagaaaatagagtgtgagagtggggtggaagactgtggccggtaccct
tctgtaattgaatttggtaaatatgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttgctaagacactccaagaagtgtggatggtttcatcctccagcaaatgaa
atttaccgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgat
gtcgagccattccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctagaagagaaggccaagcaggttctcctgaaaagcctctctccgatctgggccgtctc
tcctacctggcatattggaagagcgtcatcttggagtatctctaccaccaccatgagagg
cacatcagcatcaaggcaattagcagagcgacgggcatgtgcccacatgacattgccacc
actctacagcacctccacatgatcgacaagagagatggcagatttgtcatcattagacgg
gaaaagttgatattgagccacatggaaaagctgaaaacctgttccagagccaatgaactt
gatccagacagtctgaggtggaccccaattttaatttctaatgctgcagtgtctgaagaa
gagcgagaagctgagaaagaggctgagcggctaatggaacaagctagctgctgggagaag
gaggaacaagaaatcctgtcaactagagctaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtcacaggggagcgagggcag
ctgctggagctgtctaaagagagcagtgaagaagaggaggaggaggacgaggaggaggag
gaagaggaggaggaggaagaggaagaggatgaagaggaggaagaagaggaggaggaagaa
gaagaagaagaagaagaagaagaagaagaaaatattcaaagctctcccccaagattgacg
aaaccacagtcagttgccataaagagaaagaggccttttgtactaaagaagaaaaggggt
cgtaaacgcaggaggatcaacagcagtgtaacaacagagaccatttcagagacgacagaa
gtactgaatgagcccttcgacaactcagatgaagagaggccaatgccacagctggagcct
acctgtgagattgaagtggaggaagatggcaggaagccagtcctgagaaaagcattccaa
catcagcctgggaagaaaagacaaacagaggaagaggaaggaaaagacaatcattgcttc
aagaatgctgacccttgtagaaacaatatgaatgatgattcaagtaacttgaaagaaggc
agtaaagacaatcccgaacctctaaagtgcaaacaagtgtggccaaaaggaacaaagcga
ggtctatctaagtggaggcaaaacaaagagaggaagaccggatttaaactgaatttgtac
accccgccagaaacacccatggagcctgatgagcaggtaacagtggaagaacagaaggag
acttcagaaggaaaaaccagccccagtcccatcaggattgaggaggaggtcaaggaaact
ggggaagccctgctgcctcaagaagaaaacagaagggaagaaacatgtgcccctgtaagt
ccaaacacatcaccaggtgaaaaaccagaagatgatctcatcaaacctgaggaagaggaa
gaggaggaggaggaggaagaggaagaagaggaaggggaagaagaagaagaagaaggagga
aatgtggaaaaagatccagatggtgctaaaagccaagaaaaagaggaaccagaaatctcc
acggaaaaagaagactctgcacgtttggatgatcacgaagaggaggaggaagaggatgaa
gagccgtctcataacgaggaccatgatgcggatgacgaggatgacagccacatggagtct
gctgaagtggagaaggaagagctgcccagagaaagcttcaaagaagtactggaaaaccag
gaggcttttttagaccttaatgtgcagcctggtcactcgaacccagaggtcttaatggac
tgtggtgtcgacctgacagcttcttgtaacagtgagcccaaggagcttgctggggaccct
gaagctgtacccgaatctgacgaggagccacccccaggagaacaggcacagaagcaggac
caaaagaacagcaaagaagtcgatacagagttcaaagagggaaacccagcaaccatggaa
atcgactctgagaccgtccaggcagttcagtctttgacccaggagagcagcgaacaggac
gacacctttcaggattgtgccgagactcaagaggcctgtagaagcctacagaactacacc
cgtgcagaccaaagtccacagattgccaccacgctcgacgattgccaacagtcggaccac
agtagcccggtttcatctgtccactcccatcctggccagtccgtacgttctgtcaacagc
ccaagtgtccctgctctggaaaacagctatgcccaaatcagcccagatcaaagtgccatc
tcagtgccatctctgcagaacatggaaaccagtcccatgatggatgtcccatcagtttca
gatcattcacagcaagtcgtagacagtggatttagtgacctgggcagtatcgagagcaca
actgagaactacgaaaacccaagcagctacgattctactatgggaggcagcatctgtgga
aacggctcttcacagaacagctgctcctatagcaacctcacctccagcagtctgacacag
agcagctgtgctgtcacccagcagatgtccaacatcagcgggagctgcagcatgctgcag
caaaccagcatcagctcccctccgacctgcagcgtcaagtctcctcaaggctgtgtggtg
gagaggcctccgagcagcagccagcagctggctcagtgcagcatggctgctaacttcacc
ccacccatgcagctggctgaaatccccgagacgggcaacgccaacattggcttatacgag
cgaatgggtcagagtgattttggggctgggcattacccacagccgtcagccaccttcagc
cttgccaaactgcagcagttaactaatacacttattgatcattcattgccttacagccat
tccgctgctgtgacttcctatgcaaacagtgcctctttgtccacaccattaagtaacaca
gggcttgttcagctttctcagtctccacactccgtccctgggggaccccaagcacaagct
accatgaccccaccccccaacctgactcctcctccaatgaatctgccgccgcctcttttg
caacggaacatggctgcatcaaatattggcatctctcacagccaaagactgcaaacccag
attgccagcaagggccacgtctccatgagaaccaagtcagcgtctctgtcaccagccgct
gccacccatcagtcacaaatctatgggcgctcccagactgtagccatgcagggtcctgca
cggactttaacgatgcaaagaggcatgaacatgagtgtgaacctgatgccagccccagcc
tacaatgtcaactccgtgaacatgaacatgaacactctcaacgccatgaatgggtacagc
atgtcccagccaatgatgaacagtggctaccacagcaatcatggctatatgaatcaaacg
ccccaataccctatgcagatgcagatgggcatgatgggcacccagccatatgcccagcag
ccaatgcagaccccaccccacggtaacatgatgtacacagcccccggacatcacggctac
atgaacacaggcatgtccaaacagtctctcaatggctcctacatgagaaggtag

DBGET integrated database retrieval system