KEGG   Pongo abelii (Sumatran orangutan): 100455926Help
Entry
100455926         CDS       T01416                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100455926 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 1870 aa AA seqDB search
PRADPIPICSFCLGTKESNREKKPEELLSCADCGSSGHPSCLKFCPELTTNVKALRWQCI
ECKTCSACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPKGMWICQVCRPKKKGRKLL
HEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDEGSMNAFTGRGSPGRGQKTKVCTTPSSG
HAASGKDSSSRLAVTDPTRPGATTKITTTSTYISASTLKVNKKTKGLIDGLTKFFTPSPD
GRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLATGTTQKLKPPPSSLPPPTPISGQSPSS
QKSSTATSSPSPQSSSSQCSMPSLSSLTTNSQLKALFDGLSHIYTTQGQSRKKGHPSYAP
PKRMRRKTELSSTAKSKAHFFGKRDIRSRFISHSSSSSWGMARGSIFKAIAHFKRTTFLK
KHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKPDQDDDTEIKINIKQESADVNVIGNKDV
VTEEDLDVFKQAQELSWEKIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPK
LYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEVDGNMSKIYCQNLCLL
AKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYFSNEKLCQQKYNVSCIMIMPQHQRQ
GFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYLAYWKSVILEYLYHHHERHISIKAI
SRATGMCPHDIATTLQHLHMIDKRDGRFVIIRREKLILSHMEKLKTCSRANELDPDSLRW
TPILISNAAVSEEEREAEKEAERLMEQASCWEKEEQEILSTRANSRQSPAKVQSKNKYLH
SPESRPVTGERGQLLELSKESSEEEEEEDEEEEEEEEEEEEEDEEEEEEEEEEEEEEEEE
EEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINSSVTTETISETTEVLNEPFD
NSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPCR
NNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRGLSKWRQNKERKTGFKLNLYTPPETPM
EPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEALLPQEENRREETCAPVSPNTSPGE
KPEDDLIKPEEEEEEEEEEEEEEEGEEEEEEGGNVEKDPDGAKSQEKEEPEISTEKEDSA
RLDDHEEEEEEDEEPSHNEDHDADDEDDSHMESAEVEKEELPRESFKEVLENQEAFLDLN
VQPGHSNPEVLMDCGVDLTASCNSEPKELAGDPEAVPESDEEPPPGEQAQKQDQKNSKEV
DTEFKEGNPATMEIDSETVQAVQSLTQESSEQDDTFQDCAETQEACRSLQNYTRADQSPQ
IATTLDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVPALENSYAQISPDQSAISVPSLQN
METSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNGSSQNS
CSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSISSPPTCSVKSPQGCVVERPPSSS
QQLAQCSMAANFTPPMQLAEIPETGNANIGLYERMGQSDFGAGHYPQPSATFSLAKLQQL
TNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMTPPPN
LTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTKSASLSPAAATHQSQI
YGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMN
SGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHGNMMYTAPGHHGYMNTGMSK
QSLNGSYMRR
NT seq 5613 nt NT seq  +upstreamnt  +downstreamnt
ccccgtgctgatcccattccaatatgtagcttctgtttggggactaaagaatcaaatcgt
gaaaagaaaccagaagaactcctctcttgtgcggattgtggcagtagtggacacccatcc
tgtttgaaattttgtcctgaattgacaacaaatgtaaaggccttaaggtggcagtgcatc
gaatgcaagacatgcagtgcctgtagagtccaaggcagaaatgctgataatatgcttttt
tgtgattcctgtgatagaggatttcatatggaatgctgtgacccaccactttccagaatg
ccaaaagggatgtggatttgccaagtctgcagaccaaagaaaaagggaagaaaactactt
catgagaaagctgcacaaataaaacgacgatatgcaaaacccattggacgaccgaaaaat
aaattaaagcaacgattgttgtctgtaaccagtgatgaaggatccatgaatgcattcaca
ggaagggggtcacctggtaggggtcaaaagactaaagtctgtaccacaccttcatctggt
catgctgcatctgggaaggactcaagcagcagattggctgttacagaccccactcggcct
ggtgccaccaccaaaatcaccaccacctccacctacatttctgcctctacacttaaagtt
aacaagaaaaccaaagggctcattgatggccttactaagttttttacaccatcacctgat
ggtcgcagatcacgaggtgaaataatagacttttcaaagcactatcgtccaaggaaaaag
gtctctcagaaacagtcatgcacttctcatgtgttggctacaggtaccacacaaaagcta
aaacctccaccttcttcacttccacccccaacccccatctctggtcagagccccagttca
caaaagtccagcacggccacttcttctccctctccccagagttcttccagccagtgcagt
atgccctccctgagcagccttaccactaacagccagctgaaggcactctttgatgggctt
tctcatatctataccactcagggacagtctcgcaaaaagggacacccgagttatgcacca
cccaaacgtatgcgtcgtaaaactgaattatcttccacggcaaaatctaaagcccacttc
tttggcaaaagagatattagaagtcggtttatttctcactcctcctcctctagctggggg
atggctagaggaagtatttttaaagcaattgctcacttcaagcgaacaactttccttaaa
aagcacaggatgctaggcagattaaaatataaagtgacccctcagatggggaccccctca
ccagggaaggggagcttgacagacggaaggattaaacctgatcaggatgatgatactgaa
ataaaaataaacatcaaacaagaaagtgcagatgtaaatgtgattggaaacaaggatgtc
gttactgaagaggatttggatgtttttaagcaggcccaggaactttcttgggagaaaata
gagtgtgagagtggggtggaagactgtggccggtacccttctgtaattgaatttggtaaa
tatgaaatccaaacctggtactcctcgccttacccacaggaatatgcaagattaccaaag
ctttacctgtgtgaattctgtcttaaatatatgaaaagtaaaaatattttgctaagacac
tccaagaagtgtggatggtttcatcctccagcaaatgaaatttaccgaaggaaagacctt
tcagtatttgaggttgatgggaatatgagcaaaatttattgccaaaacctttgtttgtta
gccaagctcttcctggaccacaaaacgttgtattatgatgtcgagccattccttttttat
gtccttacaaaaaatgatgaaaagggctgtcatctggttggatacttctctaatgaaaag
ctttgccagcagaagtataatgtctcctgcataatgatcatgccccagcaccaaaggcaa
ggatttggacggtttctcattgatttcagctatttgctttctagaagagaaggccaagca
ggttctcctgaaaagcctctctccgatctgggccgtctctcctacctggcatattggaag
agcgtcatcttggagtatctctaccaccaccatgagaggcacatcagcatcaaggcaatt
agcagagcgacgggcatgtgcccacatgacattgccaccactctacagcacctccacatg
atcgacaagagagatggcagatttgtcatcattagacgggaaaagttgatattgagccac
atggaaaagctgaaaacctgttccagagccaatgaacttgatccagacagtctgaggtgg
accccaattttaatttctaatgctgcagtgtctgaagaagagcgagaagctgagaaagag
gctgagcggctaatggaacaagctagctgctgggagaaggaggaacaagaaatcctgtca
actagagctaacagtaggcaatcacctgcaaaagtacaatcgaaaaataaatatttgcat
tccccggagagccggccagtcacaggggagcgagggcagctgctggagctgtctaaagag
agcagtgaagaagaggaagaggaggacgaggaggaggaggaagaggaggaggaggaagag
gaagaggatgaagaggaggaagaagaggaggaggaagaagaagaagaagaagaagaagaa
gaagaagaaaatattcaaagctctcccccaagattgacgaaaccacagtcagttgccata
aagagaaagaggccttttgtactaaagaagaaaaggggtcgtaaacgcaggaggatcaac
agcagtgtaacaacagagaccatttcagagacgacagaagtactgaatgagcccttcgac
aactcagatgaagagaggccaatgccacagctggagcctacctgtgagattgaagtggag
gaagatggcaggaagccagtcctgagaaaagcattccaacatcagcctgggaagaaaaga
caaacagaggaagaggaaggaaaagacaatcattgcttcaagaatgctgacccttgtaga
aacaatatgaatgatgattcaagtaacttgaaagaaggcagtaaagacaatcccgaacct
ctaaagtgcaaacaagtgtggccaaaaggaacaaagcgaggtctatctaagtggaggcaa
aacaaagagaggaagaccggatttaaactgaatttgtacaccccgccagaaacacccatg
gagcctgatgagcaggtaacagtggaagaacagaaggagacttcagaaggaaaaaccagc
cccagtcccatcaggattgaggaggaggtcaaggaaactggggaagccctgctgcctcaa
gaagaaaacagaagggaagaaacatgtgcccctgtaagtccaaacacatcaccaggtgaa
aaaccagaagatgatctcatcaaacctgaggaagaggaagaggaggaggaggaggaagag
gaagaagaggaaggggaagaagaagaagaagaaggaggaaatgtggaaaaagatccagat
ggtgctaaaagccaagaaaaagaggaaccagaaatctccacggaaaaagaagactctgca
cgtttggatgatcacgaagaggaggaggaagaggatgaagagccgtctcataacgaggac
catgatgcggatgacgaggatgacagccacatggagtctgctgaagtggagaaggaagag
ctgcccagagaaagcttcaaagaagtactggaaaaccaggaggcttttttagaccttaat
gtgcagcctggtcactcgaacccagaggtcttaatggactgtggtgtcgacctgacagct
tcttgtaacagtgagcccaaggagcttgctggggaccctgaagctgtacccgaatctgac
gaggagccacccccaggagaacaggcacagaagcaggaccaaaagaacagcaaagaagtc
gatacagagttcaaagagggaaacccagcaaccatggaaatcgactctgagaccgtccag
gcagttcagtctttgacccaggagagcagcgaacaggacgacacctttcaggattgtgcc
gagactcaagaggcctgtagaagcctacagaactacacccgtgcagaccaaagtccacag
attgccaccacgctcgacgattgccaacagtcggaccacagtagcccggtttcatctgtc
cactcccatcctggccagtccgtacgttctgtcaacagcccaagtgtccctgctctggaa
aacagctatgcccaaatcagcccagatcaaagtgccatctcagtgccatctctgcagaac
atggaaaccagtcccatgatggatgtcccatcagtttcagatcattcacagcaagtcgta
gacagtggatttagtgacctgggcagtatcgagagcacaactgagaactacgaaaaccca
agcagctacgattctactatgggaggcagcatctgtggaaacggctcttcacagaacagc
tgctcctatagcaacctcacctccagcagtctgacacagagcagctgtgctgtcacccag
cagatgtccaacatcagcgggagctgcagcatgctgcagcaaaccagcatcagctcccct
ccgacctgcagcgtcaagtctcctcaaggctgtgtggtggagaggcctccgagcagcagc
cagcagctggctcagtgcagcatggctgctaacttcaccccacccatgcagctggctgaa
atccccgagacgggcaacgccaacattggcttatacgagcgaatgggtcagagtgatttt
ggggctgggcattacccacagccgtcagccaccttcagccttgccaaactgcagcagtta
actaatacacttattgatcattcattgccttacagccattccgctgctgtgacttcctat
gcaaacagtgcctctttgtccacaccattaagtaacacagggcttgttcagctttctcag
tctccacactccgtccctgggggaccccaagcacaagctaccatgaccccaccccccaac
ctgactcctcctccaatgaatctgccgccgcctcttttgcaacggaacatggctgcatca
aatattggcatctctcacagccaaagactgcaaacccagattgccagcaagggccacgtc
tccatgagaaccaagtcagcgtctctgtcaccagccgctgccacccatcagtcacaaatc
tatgggcgctcccagactgtagccatgcagggtcctgcacggactttaacgatgcaaaga
ggcatgaacatgagtgtgaacctgatgccagccccagcctacaatgtcaactccgtgaac
atgaacatgaacactctcaacgccatgaatgggtacagcatgtcccagccaatgatgaac
agtggctaccacagcaatcatggctatatgaatcaaacgccccaataccctatgcagatg
cagatgggcatgatgggcacccagccatatgcccagcagccaatgcagaccccaccccac
ggtaacatgatgtacacagcccccggacatcacggctacatgaacacaggcatgtccaaa
cagtctctcaatggctcctacatgagaaggtag

DBGET integrated database retrieval system