KEGG   Pongo abelii (Sumatran orangutan): 100455969Help
Entry
100455969         CDS       T01416                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pon00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pon00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 187 aa AA seqDB search
MVRLLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS
VYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEEKGIKYKF
EVYEKND
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtttgctaaactgcatcgtcgctgtgtcccaaaacatgggcatcggcaagaac
ggggacctgccctggccgccgctcaggaatgaattcaggtatttccagagaatgaccaca
acttcttcagtagagggtaaacagaatctggtgattatgggtcggaagacctggttctcc
attcctgagaagaatcgacctttaaaggatagaattaatttagttctcagcagagaactc
aaggaacctccacaaggagctcattttcttgccagaagtttggatgatgccttaaaactt
actgaacgaccagaattagcaaataaagtagacatgatttggatagttggtggcagttct
gtttataaggaagccatgaatcacctaggccatcttaaactatttgtgacaaggatcatg
caggactttgaaagtgacacgtttttttcagaaattgatttggagaaatataaacttctg
ccagaatacccaggtgttctctctgatgtccaggaggagaaaggcattaagtacaaattt
gaagtatatgagaagaatgattaa

DBGET integrated database retrieval system