KEGG   Pongo abelii (Sumatran orangutan): 100455969Help
Entry
100455969         CDS       T01416                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100455969
   00670 One carbon pool by folate
    100455969
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100455969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 187 aa AA seqDB search
MVRLLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS
VYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEEKGIKYKF
EVYEKND
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtttgctaaactgcatcgtcgctgtgtcccaaaacatgggcatcggcaagaac
ggggacctgccctggccgccgctcaggaatgaattcaggtatttccagagaatgaccaca
acttcttcagtagagggtaaacagaatctggtgattatgggtcggaagacctggttctcc
attcctgagaagaatcgacctttaaaggatagaattaatttagttctcagcagagaactc
aaggaacctccacaaggagctcattttcttgccagaagtttggatgatgccttaaaactt
actgaacgaccagaattagcaaataaagtagacatgatttggatagttggtggcagttct
gtttataaggaagccatgaatcacctaggccatcttaaactatttgtgacaaggatcatg
caggactttgaaagtgacacgtttttttcagaaattgatttggagaaatataaacttctg
ccagaatacccaggtgttctctctgatgtccaggaggagaaaggcattaagtacaaattt
gaagtatatgagaagaatgattaa

DBGET integrated database retrieval system