KEGG   Pongo abelii (Sumatran orangutan): 100456049Help
Entry
100456049         CDS       T01416                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01523  Antifolate resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04064  NF-kappa B signaling pathway
pon04066  HIF-1 signaling pathway
pon04071  Sphingolipid signaling pathway
pon04137  Mitophagy - animal
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04218  Cellular senescence
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04917  Prolactin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04926  Relaxin signaling pathway
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease (NAFLD)
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05030  Cocaine addiction
pon05132  Salmonella infection
pon05133  Pertussis
pon05134  Legionellosis
pon05140  Leishmaniasis
pon05142  Chagas disease (American trypanosomiasis)
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  HTLV-I infection
pon05167  Kaposi's sarcoma-associated herpesvirus infection
pon05168  Herpes simplex infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05212  Pancreatic cancer
pon05215  Prostate cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05321  Inflammatory bowel disease (IBD)
pon05418  Fluid shear stress and atherosclerosis
Module
pon_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100456049 (RELA)
   04010 MAPK signaling pathway
    100456049 (RELA)
   04064 NF-kappa B signaling pathway
    100456049 (RELA)
   04668 TNF signaling pathway
    100456049 (RELA)
   04066 HIF-1 signaling pathway
    100456049 (RELA)
   04071 Sphingolipid signaling pathway
    100456049 (RELA)
   04024 cAMP signaling pathway
    100456049 (RELA)
   04151 PI3K-Akt signaling pathway
    100456049 (RELA)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    100456049 (RELA)
  Cell growth and death
   04210 Apoptosis
    100456049 (RELA)
   04218 Cellular senescence
    100456049 (RELA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100456049 (RELA)
   04621 NOD-like receptor signaling pathway
    100456049 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100456049 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100456049 (RELA)
   04625 C-type lectin receptor signaling pathway
    100456049 (RELA)
   04660 T cell receptor signaling pathway
    100456049 (RELA)
   04658 Th1 and Th2 cell differentiation
    100456049 (RELA)
   04659 Th17 cell differentiation
    100456049 (RELA)
   04657 IL-17 signaling pathway
    100456049 (RELA)
   04662 B cell receptor signaling pathway
    100456049 (RELA)
   04062 Chemokine signaling pathway
    100456049 (RELA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100456049 (RELA)
   04917 Prolactin signaling pathway
    100456049 (RELA)
   04926 Relaxin signaling pathway
    100456049 (RELA)
  Nervous system
   04722 Neurotrophin signaling pathway
    100456049 (RELA)
  Development
   04380 Osteoclast differentiation
    100456049 (RELA)
  Aging
   04211 Longevity regulating pathway - mammal
    100456049 (RELA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100456049 (RELA)
   05202 Transcriptional misregulation in cancers
    100456049 (RELA)
   05203 Viral carcinogenesis
    100456049 (RELA)
   05212 Pancreatic cancer
    100456049 (RELA)
   05221 Acute myeloid leukemia
    100456049 (RELA)
   05220 Chronic myeloid leukemia
    100456049 (RELA)
   05215 Prostate cancer
    100456049 (RELA)
   05222 Small cell lung cancer
    100456049 (RELA)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    100456049 (RELA)
  Substance dependence
   05030 Cocaine addiction
    100456049 (RELA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100456049 (RELA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100456049 (RELA)
   04931 Insulin resistance
    100456049 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100456049 (RELA)
  Infectious diseases
   05132 Salmonella infection
    100456049 (RELA)
   05133 Pertussis
    100456049 (RELA)
   05134 Legionellosis
    100456049 (RELA)
   05152 Tuberculosis
    100456049 (RELA)
   05166 HTLV-I infection
    100456049 (RELA)
   05162 Measles
    100456049 (RELA)
   05164 Influenza A
    100456049 (RELA)
   05161 Hepatitis B
    100456049 (RELA)
   05160 Hepatitis C
    100456049 (RELA)
   05168 Herpes simplex infection
    100456049 (RELA)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100456049 (RELA)
   05169 Epstein-Barr virus infection
    100456049 (RELA)
   05165 Human papillomavirus infection
    100456049 (RELA)
   05146 Amoebiasis
    100456049 (RELA)
   05145 Toxoplasmosis
    100456049 (RELA)
   05140 Leishmaniasis
    100456049 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    100456049 (RELA)
  Drug resistance
   01523 Antifolate resistance
    100456049 (RELA)
Transcription factors [BR:pon03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100456049 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 100456049
NCBI-ProteinID: XP_002821553
Ensembl: ENSPPYG00000003053
UniProt: H2NCU5
Position
11
AA seq 551 aa AA seqDB search
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQASAPAPAPAMVSALAQAPAPVPVLPPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtacgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcaatcagcgcatccagaccaacaacaacccc
ttccaagttcctatagaagagcagcgtggggactatgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggatccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccaccgacccccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct
gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat
gatgagtttcccaccatggtgtttccttctgggcagataagccaggcctcagccttggcc
ccggcccctccccaagtcctgccccaggcttcagcccctgcccctgctccagccatggta
tcagctctggcccaggccccagcccctgtcccagtcctacccccaggccctcctcaggct
gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
gccgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag
ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc
ccagggctccccaacggcctcctttcaggagatgaagacttctcttccattgcggacatg
gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system