KEGG   Pongo abelii (Sumatran orangutan): 100456193Help
Entry
100456193         CDS       T01416                                 

Gene name
CLK3
Definition
(RefSeq) dual specificity protein kinase CLK3
  KO
K08823  CDC-like kinase [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100456193 (CLK3)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  CLK family
   100456193 (CLK3)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100456193 (CLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100456193
NCBI-ProteinID: XP_024088085
Ensembl: ENSPPYG00000006641
Position
15
AA seq 638 aa AA seqDB search
MPVLSARRRELTDHAGSGRRSGPSPAAGSGPHLSALRAQPARAAHLSGRGTYVRRDSAGG
GPGQARPLGPPGTSLRGRGAHRSREGWCPGAFESGARAARPPSRVEPGLATAASREGAGL
PRAEVAAGSGRGARSGEWGLAAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEG
RLRYPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGSSRSRHR
RRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWL
QERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKD
KENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALR
FLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHT
TIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGP
IPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRM
LEFDPAQRITLAEALLHPFFAGLTPEERSFHTSRNPSR
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcctctccgcgcgcaggagggagttgacggaccacgcggggtcggggcgacgg
agcggtcccagccccgcggccgggtcggggccccacctctcggctctgagagcccagcca
gcccgggccgcgcacctgtcaggtcgggggacctacgtgcgccgcgactcggcaggaggc
gggccaggccaggctcgtcccctcggccctcccggaactagtctccgaggccgcggcgcc
caccggagcagagagggctggtgccccggagccttcgagtcgggggctagagcggccagg
cctccgagccgggtcgagccggggctggcgacggctgcgtcacgcgagggggcggggctg
ccacgggcggaggtcgcagccggaagcggaagaggcgctcggagcggggagtggggccta
gctgcagccggagcctgggagacgatgcatcactgtaagcgataccgctcccctgaacca
gacccgtacctgagctaccgatggaaaaggaggaggtcctacagtcgggaacatgaaggg
agactgcgatacccatcccgaagggagcctcccccacggagatctcggtccagaagccat
gaccgcctgccctaccagaggaggtaccgggagcgccgtgacagcgatacataccggtgt
gaagagcggagcccatcctttggagaggactactatggatcttcacgttctcgtcatcgt
cggcgatcgcgggagagggggccataccggacccgcaagcacgcccaccactgccacaaa
cgccgcaccaggtcttgtagcagcgcctcctcgagaagccaacagagcagtaagcgcagc
agccggagtgtggaagatgacaaggagggtcacctggtgtgccggatcggcgattggctc
caagagcgatatgagattgtggggaacctgggtgaaggcacctttggcaaggtggtggag
tgcttggaccatgccagagggaagtctcaggttgccctgaagatcatccgcaatgtgggc
aagtaccgggaggctgcccggctagaaatcaacgtgctcaaaaaaatcaaggagaaggac
aaagaaaacaagttcctgtgcgtcttgatgtctgactggttcaacttccacggtcacatg
tgcatcgcctttgagctcctgggcaagaacacctttgagttcctgaaggagaataacttc
cagccttaccccctaccacatgtccggcacatggcctaccagctctgccacgcccttaga
tttctgcatgagaatcagctgacccatacagacttgaagccagagaacatcctgtttgtg
aattctgagtttgaaaccctctacaatgagcacaagagctgtgaggagaagtcagtgaag
aacaccagcatccgagtggctgactttggcagtgccacatttgaccatgagcatcacaca
accattgtggccacccgtcactatcgcccgcctgaggtgatccttgagctgggctgggca
cagccctgtgacgtctggagcattggctgcattctgtttgagtactaccggggcttcaca
ctcttccagacccacgaaaaccgagagcacctggtgatgatggagaagatcctagggccc
atcccatcacacatgatccaccgtacccggaagcagaaatatttctacaaagggggccta
gtttgggatgagaacagctctgacggccggtatgtgaaggagaactgcaaacctctgaag
agttacatgctccaagactccctggagcacgtgcagctgtttgacctgatgaggaggatg
ttagaatttgaccctgcccagcgcatcacactggccgaggccctgctgcaccccttcttt
gctggcctgacccctgaggagcggtccttccacaccagccgcaacccaagcagatga

DBGET integrated database retrieval system