KEGG   Pongo abelii (Sumatran orangutan): 100456193Help
Entry
100456193         CDS       T01416                                 

Gene name
CLK3
Definition
CDC-like kinase 3
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 417 aa AA seqDB search
MKCWDLENPTNQPTGSSPSPPLPLTDTSICQSEPPTMRLVGWRFGGRCMQRSQQSSKRSS
RSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGK
YREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQ
PYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKN
TSIRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTL
FQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKS
YMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSFHTSRNPSR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgctgggatctggaaaatccaaccaaccaacccaccggctcctcaccgtctcca
cctctgcctttgactgacacctcaatctgtcaatcggaaccgcctaccatgcgattggtc
ggatggcgtttcggggggcggtgcatgcagagaagccaacagagcagtaagcgcagcagc
cggagtgtggaagatgacaaggagggtcacctggtgtgccggatcggcgattggctccaa
gagcgatatgagattgtggggaacctgggtgaaggcacctttggcaaggtggtggagtgc
ttggaccatgccagagggaagtctcaggttgccctgaagatcatccgcaatgtgggcaag
taccgggaggctgcccggctagaaatcaacgtgctcaaaaaaatcaaggagaaggacaaa
gaaaacaagttcctgtgcgtcttgatgtctgactggttcaacttccacggtcacatgtgc
atcgcctttgagctcctgggcaagaacacctttgagttcctgaaggagaataacttccag
ccttaccccctaccacatgtccggcacatggcctaccagctctgccacgcccttagattt
ctgcatgagaatcagctgacccatacagacttgaagccagagaacatcctgtttgtgaat
tctgagtttgaaaccctctacaatgagcacaagagctgtgaggagaagtcagtgaagaac
accagcatccgagtggctgactttggcagtgccacatttgaccatgagcatcacacaacc
attgtggccacccgtcactatcgcccgcctgaggtgatccttgagctgggctgggcacag
ccctgtgacgtctggagcattggctgcattctgtttgagtactaccggggcttcacactc
ttccagacccacgaaaaccgagagcacctggtgatgatggagaagatcctagggcccatc
ccatcacacatgatccaccgtacccggaagcagaaatatttctacaaagggggcctagtt
tgggatgagaacagctctgacggccggtatgtgaaggagaactgcaaacctctgaagagt
tacatgctccaagactccctggagcacgtgcagctgtttgacctgatgaggaggatgtta
gaatttgaccctgcccagcgcatcacactggccgaggccctgctgcaccccttctttgct
ggcctgacccctgaggagcggtccttccacaccagccgcaacccaagcagatga

DBGET integrated database retrieval system