KEGG   Pongo abelii (Sumatran orangutan): 100456382Help
Entry
100456382         CDS       T01416                                 

Definition
trypsin-like
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100456382
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100456382
   04974 Protein digestion and absorption
    100456382
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100456382
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100456382
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100456382
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100456382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 246 aa AA seqDB search
MKTSIFLALLGAATAFPTSDDDDKIIGGYICQRNSVPYQVSLNAGYHFCGSSLINNKWVV
SAAHCYKSRIQVRLGEYNIKVYEGNEQFINAAKIICHPKYNSATIDNDIMLIKLSSAATI
NSQVATISLPRSCAAAGTQCLISGWGNTLSSGTNYPDLLQCLKAPILXTACHTAYPGKIT
TNMICLGFLEGGKDSCQGDSGCPVVCNGELQGIVSWGYDCTQKNKPGVYTKVCNYVKWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctccatcttccttgctctcctgggagctgctaccgctttccccactagtgat
gatgatgacaagatcattgggggctacatctgtcagaggaattctgtcccctatcaggtg
tccctgaatgctggctatcacttctgtggcagctccctcatcaataacaaatgggtggtg
tccgcggctcactgctacaagtcccgaatccaagtgcgtcttggagaatacaacattaag
gtctatgaaggcaatgaacaattcataaatgcagccaagattatttgccacccgaagtat
aactcagccaccattgataatgacatcatgctgattaagctgagctcagccgccaccatc
aactctcaagtggccaccatctctctgccaagatcctgtgcagcggctggtactcagtgc
ctcatctctggctggggcaacaccctgagcagtggcaccaactaccctgatctcctgcag
tgtctgaaggctcccattctanacactgcttgccacacagcctacccaggcaagattact
acaaacatgatatgtctgggattcctggagggtggaaaggactcttgccagggtgactct
ggttgccctgtggtctgcaacggagaactccagggcattgtctcctggggctatgattgt
actcagaagaacaaacctggagtctacactaaagtttgcaactatgtgaaatggattcag
cagaccattgctgccaactaa

DBGET integrated database retrieval system