KEGG   Pongo abelii (Sumatran orangutan): 100456382Help
Entry
100456382         CDS       T01416                                 

Definition
cationic trypsin-3-like
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:pon04080]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:pon04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:pon04974]
Human Diseases; Infectious diseases; Influenza A [PATH:pon05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 246 aa AA seqDB search
MKTSIFLALLGAATAFPTSDDDDKIIGGYICQRNSVPYQVSLNAGYHFCGSSLINNKWVV
SAAHCYKSRIQVRLGEYNIKVYEGNEQFINAAKIICHPKYNSATIDNDIMLIKLSSAATI
NSQVATISLPRSCAAAGTQCLISGWGNTLSSGTNYPDLLQCLKAPILXTACHTAYPGKIT
TNMICLGFLEGGKDSCQGDSGCPVVCNGELQGIVSWGYDCTQKNKPGVYTKVCNYVKWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctccatcttccttgctctcctgggagctgctaccgctttccccactagtgat
gatgatgacaagatcattgggggctacatctgtcagaggaattctgtcccctatcaggtg
tccctgaatgctggctatcacttctgtggcagctccctcatcaataacaaatgggtggtg
tccgcggctcactgctacaagtcccgaatccaagtgcgtcttggagaatacaacattaag
gtctatgaaggcaatgaacaattcataaatgcagccaagattatttgccacccgaagtat
aactcagccaccattgataatgacatcatgctgattaagctgagctcagccgccaccatc
aactctcaagtggccaccatctctctgccaagatcctgtgcagcggctggtactcagtgc
ctcatctctggctggggcaacaccctgagcagtggcaccaactaccctgatctcctgcag
tgtctgaaggctcccattctanacactgcttgccacacagcctacccaggcaagattact
acaaacatgatatgtctgggattcctggagggtggaaaggactcttgccagggtgactct
ggttgccctgtggtctgcaacggagaactccagggcattgtctcctggggctatgattgt
actcagaagaacaaacctggagtctacactaaagtttgcaactatgtgaaatggattcag
cagaccattgctgccaactaa

DBGET integrated database retrieval system