KEGG   Pongo abelii (Sumatran orangutan): 100456449Help
Entry
100456449         CDS       T01416                                 

Gene name
USP22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100456449 (USP22)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100456449 (USP22)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100456449 (USP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 746 aa AA seqDB search
MAPGWPLTIRGLPTGGAPACGREQRLAGSWQFQPRATALQGPTQVRATGGPADSSRLRGA
VGWESAGPGWKPDLRRSSSSPRLFAAELRPAQTGSVLGRTPRAAQPQHAPTSPVLWKRQG
TSSRQGPGRRLCTRRTVLRAYDNGRRAQRRRSAAAAARGRCLPCSLPSAIAQPHLCPASV
LCSRRPCLGRPGPPPSSPHAALASSSPPSPPPPARGRALPPMVSRPEPEGEAMDAELAVA
PPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKSCICHVCGVHLNRLHSCLYC
VFFGCFTKKHIHEHAKSKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQ
GVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLINLGNTCFMNCIVQALTHTPL
LRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYE
QQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVST
TIDPFWDISLDLPGSSTPFWPLSPGSEGNVVNGESHVSGTTTLTDCLRRFTRPEHLGSSA
KIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLELDMTPFMA
SSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDDAII
TKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccggttggcccctcactatccgcgggctcccgacaggaggcgccccagcttgc
ggccgggagcagcgcctagcaggcagttggcagttccaaccccgggccacggcactgcag
ggcccgacccaggttagggcaaccgggggtcccgcagacagctcccgattacggggtgct
gttgggtgggaaagcgcaggccctggatggaagcccgacctgcggcgctccagctcatcg
ccccgcctctttgcggcagagctcaggccggcgcaaaccggttcagtgctaggacggacg
cctcgcgccgcccaaccgcagcacgcccccacctccccagtcctctggaagagacaggga
acatctagtcgccagggtcccgggaggcggctctgtaccagacggactgtactgagagcc
tatgacaatggccgaagagcgcagcgcaggcggtccgcagcagccgcagctcgggggcgg
tgcctgccctgcagcctcccctcggcgatcgcgcagccccatctttgtccggcctctgtg
ctttgttctcggcgcccgtgccttggccggccaggcccgccgccgagcagcccccacgcc
gcgctggcgtcgtcctcgcctccctcgccgccgccccccgcgcgcggccgggccttgccc
cccatggtgtcccggccagagcccgagggcgaggccatggacgccgagctggcagtagcg
cctccgggctgctcgcacctgggcagcttcaaggtggacaactggaagcagaacctgcgg
gccatctaccagtgcttcgtgtggagcggcacggctgaggcccgcaagcgcaaggccaag
tcctgtatctgccatgtctgtggcgtccacctcaacaggctgcattcctgcctctactgt
gtcttcttcggctgtttcacaaagaagcatattcacgagcatgcgaagtcgaagcggcat
aacctggccattgatctgatgtacggaggcatctactgttttctgtgccaggactacatc
tatgacaaagacatggaaataatcgccaaggaggagcagcgaaaggcttggaaaatgcaa
ggcgttggagagaagttttcaacttgggaaccaaccaaacgggagcttgaactgctgaag
cacaacccgaaaaggagaaagatcacctcgaactgcaccataggtctgcgcgggctgatc
aaccttgggaacacgtgcttcatgaactgcatcgtgcaggccctgacccacacgccactt
ctgcgggacttcttcctgtctgacaggcaccgctgtgagatgcagagccccagctcctgt
ctggtctgtgagatgtcctcactgtttcaggagttttactctggacaccggtcccctcac
atcccgtataagttgctgcacctggtgtggacccacgcgaggcacctggcaggctacgag
cagcaggacgcccacgagttcctcatcgcggccctggatgtgctccaccgacactgcaaa
ggtgatgacaatgggaagaaggccaacaaccccaaccactgcaactgcatcatagaccag
atcttcacgggcgggctgcagtcagacgtcacctgccaagtctgccatggagtctctacc
accatcgaccccttctgggacatcagcttggatctccccggctcttccaccccattctgg
cccctgagcccagggagcgagggcaacgtggtaaacggggaaagccacgtgtcgggaacc
accacgctcacggactgcctgcgacgattcaccagaccagagcacttgggcagcagcgcc
aagatcaagtgcagcggttgccatagctaccaggagtccacaaagcagctcactatgaag
aaactgcccatcgtagcctgttttcatctcaaacgatttgaacactcagccaagctgcgg
cggaagatcaccacgtatgtgtccttccccctggagctggacatgacccctttcatggcc
tccagcaaagagagcaggatgaatggacagtaccagcagcccacggacagtctcaacaat
gacaacaagtattccctgtttgctgttgttaaccatcaaggaaccttggagagtggccac
tacaccagctttatccggcagcacaaagaccagtggttcaagtgtgacgatgccatcatc
accaaggccagcatcaaggacgtcctggacagcgaagggtacttgctgttctatcacaaa
cagttcctggaatacgagtag

DBGET integrated database retrieval system