KEGG   Pongo abelii (Sumatran orangutan): 100456480Help
Entry
100456480         CDS       T01416                                 

Gene name
POM121C, POM121
Definition
POM121 transmembrane nucleoporin C
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100456480 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 1229 aa AA seqDB search
MSPAAAAAGAGERRRPIATVRDGRGRGCGGPAGAALLGLSLVGLLLYLVPAAAALAWLAV
GTTAAWWGLSREPRGSRPLSSFVRKARHRRTLFASPPAKSTANGNLLEPRTLLEGPDPAE
LLLMGSYLGKPGPPQPAPAPEGQDLRDRPGRRPPARLASRSPPSSPPTHFVHHVYPSLST
PLLRPSGRPSPRDCGTLPNRFVITPRRRYPIHQAQYSCLGVLPTVCWNGYHKKAVLSPRN
SRMVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALEEKKKKR
TVEEEDQIFVDGQENKRRRHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDD
HLNKRSRSSSMSSLTGAYTSGIPSSSRNAITSSYSSTRGISQLWKRSGPSSSPFSSPASS
RSQTPERPAKKIREEELCHHSSSSTPLATDKESQGEKVADTTPRKKQNSNSQSTPGSSGQ
RKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSDAASNSVT
ETPPTTQPPFTFTLPPAATASPPTSLLAPSTNPLLESLKKMQSPPSLPPCPESAGAATTE
APSPPKTPSLLPPLGLSQSGPPGLLPSPSLDSKPPTTLLGLIPAPCTVPATDTKAPPTLQ
AETATKPQATSAPFPAPKQSFLFGTHNTSPSSPAAPAASSASPMFKPIFTAPPKSEKEGR
TPPGPSVTATAPSSSSLPTTTSTTAPTFQPVFSSMGSPASVPLPAPFFKQTTTPATAPTT
TAPLFTGLATATSAVAPVTSASPSTDSASKPAFGFGINSVSSSSVSTTTSTATAASQPFL
FGAPQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLPTAVPTATSSSAAGFSGFGS
SLTTSAPATSSQATLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPTFGDAEGQPPGAA
KPALAPSFGSSFTFGNSAAPAPAAAPTPAPASMIKIVPAYVPTPIHPTFGGATHSAFGLK
ATASAFGTPTSSQPAFGGSTAVFSFGAATSSSFGATTQTASSGSSSSVFGSTTPSPFTFG
GSAAPAGSGSFGINVATPGSSTITGAFSFGAGQSGSTATSTPFTGGLGQNALGTTGQSTP
FAFNVGSTPESKPVFGGTATPTFGQNTPAPGVGTSGSSLSFGASSAPAQGFVGVGPFGSA
APSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctggagcaggcgagcggcggcggccgatagcgactgtc
agggacggccgaggccggggctgcggcgggccggccggggcggcgcttctcggcctgtcg
ctggtcggcctcctactgtacctcgtgcctgctgcggctgcgctggcctggctggccgtg
gggactaccgcggcctggtggggactgagccgcgagccccgaggttcgcgccccttgtcc
tccttcgttcggaaggcgcgacatcgtagaacactgttcgcttcgcctccggccaagtct
acagccaacggaaacctcctagagccgcggaccctactcgaaggacctgaccctgccgaa
ctgctactcatgggcagttacctgggcaagcccgggccgccgcagcccgcccccgctccg
gagggccaggacctgcgggataggcctggccgccgcccacccgcccgcctggcgtcgcgc
tccccaccgtcctccccgccgacccattttgttcaccacgtttacccctctctctccact
cctcttctccgaccctccgggaggccttccccacgggattgtgggactttaccaaatcgg
tttgtaataacacctcgaagacgctatccgatccatcaggcccaatattcctgtctgggg
gtacttcccacagtgtgctggaatggttatcacaagaaggctgttctatcccctcgcaac
tccaggatggtgtgtagcccagtgactgtgaggatcgcccctcctgacagaagattttcg
cgttctgcgataccagagcagataatcagctcaacactgtcctcaccatcaagtaatgcc
ccagacccatgtgcaaaggagactgtactgagtgccctcgaagagaagaagaagaaaaga
acagtggaggaagaagaccaaatattcgttgatggccaggaaaataaaagaaggcgccat
gatagcagtggcagtggacattcagcatttgagcccctggtggccaatggagtccccgct
tcttttgtgcctaagcctgggtctctgaagagaggcctcaattctcagagctcagatgac
cacttgaataagagatcccgaagctcttccatgagctccttgacaggcgcttacacaagt
ggcatccctagctccagccgcaatgccattaccagttcctacagctccacccgaggcatc
tcacagctctggaagagaagtggccccagttcatcacccttctctagcccagcctcgtcc
cgctcccagacaccggagaggccagcaaagaaaataagagaagaggagctgtgtcatcat
tccagttcttcaactccattggcgacagacaaggagtcccagggagaaaaggttgcagat
acaaccccaaggaagaaacaaaactcgaattctcagtctacacctggcagctctgggcag
cgtaagcggaaagttcagctgctgccttctcggcgaggggaacagctgaccttgcctcca
cctccccagcttggctattcgatcactgccgaggacctagacttagagaagaaggcttcg
ttacagtggttcaaccaggccttggaggacaagagcgatgctgcctcgaactctgtcact
gagaccccacctaccactcagccgccgtttacctttaccctgcctcctgctgcaactgcc
tccccacccacctccctcctggccccaagcaccaacccactgttagagagcttgaagaag
atgcagagtcccccgagcctgccgccctgcccagaatctgctggagcagcaaccactgag
gccccctcacctccaaagacacccagcctcctgcccccgctgggtttatcacagtcaggg
cctccagggctgctccccagcccctccttagactccaaacccccgaccactttgctgggg
ctgatccctgctccatgcacggtaccagccactgacaccaaggcacctccaacccttcag
gcagagacggctaccaaaccccaagccacatctgccccgttccccgcccccaaacaaagc
ttcctgtttggaacacacaacacctcaccttccagccctgccgcccctgctgcatcttca
gcatctcccatgttcaagcccattttcacggccccacccaagagtgagaaggaaggccgc
acaccgcctggcccttcagtcacagccacagcgccctccagctcctccctccccacgacc
accagcaccacagccccgaccttccagcctgtctttagcagcatggggtcacctgcgtct
gtgcccttgcctgctcccttcttcaagcagacaactactcccgccactgctcccaccaca
actgccccgctcttcactggcctggccaccgccacctctgctgtggctcccgtcacctcc
gccagtccatccacagactctgcttcgaagcctgcatttggctttggcataaacagtgtg
agcagcagcagtgtgagcaccacgaccagcaccgccactgccgcctcacagcctttcctc
ttcggggcgccccaggcctctgctgccagcttcaccccggccatgggctccatattccag
tttggcaaacctcctgccctgcccactaccaccacagtcaccaccttcagccagtccctg
cccactgccgtgccaacggccaccagcagcagcgctgccggctttagcggttttggcagc
agcctcaccacctccgccccggccaccagcagccaggccactctgacgttcagtaacacg
agcacccccacgttcaacattccctttggctcaagtgccaagtccccgctcccatcatat
ccgggagccaacccccagcccacatttggggacgctgaggggcagccaccgggggccgcc
aagccagcccttgcccccagctttggcagctctttcacttttggaaactctgcagccccg
gccccggctgctgcacccacacctgcacccgcgtccatgatcaagatcgtgcctgcgtac
gtgcctacgcccatccatcctacctttggcggtgccacgcactcggcgtttgggttgaaa
gccacggcttcggccttcggcactcccaccagctcacagcccgcctttggcggctctact
gctgtcttctccttcggtgcagccaccagctccagctttggagccaccacccagaccgcc
agcagcgggagcagcagctcggtgttcggcagcacaacaccatcacccttcacgtttggg
ggttcggcagcccccgctggcagtgggagctttgggatcaatgtggccaccccaggctcc
agcaccatcaccggagcgttcagctttggagcaggacagagtgggagcacagccacctcc
acccccttcacggggggcttaggtcagaacgccctgggcaccaccggccagagcacaccg
tttgccttcaacgtgggcagcacgcctgagagcaaacctgtgtttggaggcaccgccacc
cctacctttggtcagaacacccctgcgcctggagtgggcacatcgggcagcagcctctcc
tttggggcatcctcagcacccgcccaaggcttcgttggcgttggaccgttcggatcggcg
gccccttcattttccattggtgcgggatccaagacccccggggctcgacagcgactgcag
gcccgaaggcagcacacccgcaaaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system